(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE345

PENCW_10.PE345       Location/Qualifiers
FT   CDS_pept        join(complement(805672..805797),complement(805387..805619),
FT                   complement(804565..805309))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000161125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950867"
FT                   /orf_name="Pc13g03450"
FT                   /product="Pc13g03450 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP91414.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI0001830511"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z6"
FT                   /transl_table=1
FT                   /translation="MHVFSTILPALALLAQVSSAAYTLRDDYGASDSFFDKFNFFTDTD
FT                   PTNGFVSYVDRSTASRNGLINTGNGVYIGVDHANIATRPGRQSVRLESTATYKHGLVIL
FT                   DLAHMPSSTCGTWPAFWMLGPNWPNNGEIDIIEGVNEQTQNQVALHTSNGCTINNSGFT
FT                   GNLETPNCYVQAPGQSANSGCVIQDGSTQSYGTGFNNVGGGVYATEWTGSAISVWFFPS
FT                   YAVPADISSGNPNPAGWGTPSARFAGGCNIDSKFNDLQIVFDITFCGDWAGSVWGSSSC
FT                   ASRAWSCVDYVQNNPTAFQESYWRVRSLKVYQDAASSKGGAEGEDVGAGDEVGVNWDPS
FT                   TWYGLSARASMKHRREHYRHKRGHGHA"
     atgcacgttt tctcgaccat cctgcccgct ctggccttgt tggctcaggt atcctccgcg        60
     gcatacacgc tgcgcgacga ctatggtgcc tccgactctt tttttgacaa gttcaacttc       120
     ttcacggaca ccgaccccac caatggcttt gtgagctacg tcgaccgtag cactgcctcg       180
     cgcaacggtc tcatcaacac ggggaacggc gtctacatcg gcgtcgacca cgccaacatc       240
     gccaccagac ctggtcgcca gagcgtccgc ctggagagta ctgccaccta caagcatggt       300
     cttgttattc tcgacctggc ccatatgccc agcagcacat gcggcacctg gcctgccttc       360
     tggatgctcg gccccaactg gcccaacaac ggcgaaatcg acattatcga aggtgtgaac       420
     gagcaaaccc aaaaccaagt ggccctgcac accagcaacg ggtgcacaat caacaacagc       480
     ggcttcacag gaaacctcga gacaccaaac tgctacgtcc aagcccccgg gcaatccgca       540
     aacagcggct gcgtaatcca agacggcagc acgcagtcct acggtacagg tttcaacaat       600
     gtcggaggcg gcgtctacgc caccgaatgg accggctccg ccatatcagt ctggttcttc       660
     ccatcctacg ccgtgccggc cgatatctca tccggaaatc ccaacccggc aggctggggc       720
     acgccctcag cacgatttgc cggcggctgc aatatcgact cgaaattcaa tgatctgcag       780
     atcgtctttg atatcacatt ctgtggagat tgggcgggct cggtttgggg ttcgtcgagt       840
     tgtgccagcc gcgcctggtc gtgtgtcgac tacgtgcaga ataaccccac ggctttccag       900
     gagagttatt ggcgtgtgcg gtcgcttaag gtttatcagg atgcggctag ttctaagggt       960
     ggtgctgagg gtgaggacgt gggtgctggg gatgaggtcg gtgttaattg ggatccctcg      1020
     acgtggtatg gtctctccgc tagggcttcg atgaagcatc gtcgggagca ttatcgtcac      1080
     aagcgtggac atggccatgc ttag                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page