(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE346

PENCW_10.PE346       Location/Qualifiers
FT   CDS_pept        join(complement(812085..812378),complement(811601..812033),
FT                   complement(807475..811547))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210845" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672456"
FT                   /orf_name="Pc13g03460"
FT                   /product="Pc13g03460 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91415.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0001830512"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z7"
FT                   /transl_table=1
FT                   /translation="MAEGSEGWSREDELDLGQEDDPRQPDHGALDQTLPSPQEPAEEEL
FT                   DTIDDAEDQDSEKTARRNYLSYPETPPPRHADWTATGSVDGTGSNPDDSPSLHGSVPSS
FT                   LSSSPLALRGSPRVSPSPARRPFDLRFQSRLSSSPQSVSRAGSPFLAHLHSRQSSITSQ
FT                   LSPTPETEAEPLQGPWEVVRWTKLRKITGQAFSEIGKRNFGRPTCLAVSTSIVIGTSKG
FT                   IILVFDYQQSLKTIIGTGTPAVECGAVTSLALSADHSTVAGGHDSGDIFTWEISRSAKP
FT                   FLHIPPIPANQTETRISDGHLSGSAVIHIGFLGTRRTALVSADTRGMSFSHLATRGMGA
FT                   VGRTVKTTRILGRYPQAAAEVKRRKPSSVLAFSPLPLGNVEQPTDSLGLVAMLTPYLLV
FT                   IVSTTPVAQTQHKAPRPKEVPAHSALTGALAWFPAIRLKGKDTQTSNTKLVYCWSNVLT
FT                   VLEVSEAESDEPADKDKPPSLVFRARSRWRADEAIVAVQWLSRSVLAVFTITQRLLIIE
FT                   DYSMHVTDSVDLANRHIYHTDLFSSQLHSLVEQLDEEDDSMHGVVADAFHMSFRSYKGR
FT                   LFLLGYNEALVGNLSNWADRLLALMEAGDFIGAIRLATSYYTGESEKLTVGLPEEDVLR
FT                   QPIVQEKLLEMISASLKYAFGRNSEASNGRLENQQLEELAEVSIAACVYMSDEEFLWEE
FT                   VFNWYEEQDSAGIFLDALEPRIVDGTLRSLPPIAVKALINHFIGTHSAGRLEEIICLLD
FT                   TTTMDIDQVTTLCKQHNLYDAFIYVWNRCLMDYVGPLEELLHMIPSQPQPLVNGDYAIE
FT                   MRRQNNAMKMFPYLSFILTGRIYPTGDDMDEAEATRAKTDLYQFLFSGRVSGTVPGDTN
FT                   EADSFSQLRAMLKFDASSFMSMLNEAFEDSFLNEPESEDISTSDMLINRQYLVSILLQV
FT                   MTGDLFTPFDIIYLDMFVARNLPKYPQYILLSGTTLHQVLVRVCQYPEQEMAEDCELSA
FT                   EYLLSFYHPPDIQSMIPLFKEARFFRILKSTYRSEKQYPLLVMTYLEDPSDRDAIFTCL
FT                   QDCLRPSSGLGKKQRRDVVDVVKEHAREIAAIDVTHAARTMQDLAPDTHSTFLRVLEDD
FT                   PQKQYQYLLVLVEPQAQTADTRYSPGVENWMIERYVQLLCKYNPSHVADFVDGLRVGDI
FT                   HLEELLPSIEESGAIDAAVILLARQGQVREALDRLVAHLGTLESGLVGILQSVRDSPDS
FT                   ATTAEAIDDLIESLNKYAGVGTWLCQGQTKTAKQSRTGSTNGKRNAPTLDQPLAFDELL
FT                   WLDHIEAVVRIASNVFAFIQGNNAQISLPAQPTDSLAGESGRLTTAFRALVQQVFTALL
FT                   ASTVKSSPTTTERTDISFLRILRAFLTRAATWSPSLLELRAVLASIFSAYSYEKSLLTL
FT                   ANGMLDRDLFVHVDEVSRLRQQGWRPRGHVCEICRSRIWGPSVGEAHWSTWEARRAEVY
FT                   AHRIARRNEDGYNPSDRGKGKAADVGVGHMSHLDAGGAHGHAHVLAHREHGDRGGMSGA
FT                   NADHDHEHCHAEAGAGSSTATTVADSPPEPVVVFACRHLYHRRCVLDAISARARPAETA
FT                   FRRDHLPDWTGAELFCPTCT"
     atggctgagg gcagtgaggg ttggtcgcgc gaagatgagc ttgacctagg ccaggaagac        60
     gatcccagac aacccgacca tggcgccctc gatcaaacct taccttcccc gcaggaacca       120
     gcggaagagg aattggacac gatagacgat gcggaggacc aggattccga gaagacagcg       180
     cgacggaatt atctcagtta cccagaaacc cctccgccgc ggcatgcgga ctggaccgcg       240
     acagggagcg tggatggaac tgggtcaaac cccgacgatt ccccatcgct acatggctct       300
     gttccgtcct ccttgagtag cagtcctctc gcgctccgcg gatctccgcg agtcagccca       360
     agcccggccc gtcgcccctt tgaccttcgc ttccagtccc ggttgtcctc atccccgcaa       420
     agtgtgtcga gagccggctc gccattccta gcacatcttc actcccggca gtcttcgata       480
     accagccagc tttccccgac tccggaaacc gaagccgaac cgctccaggg gccttgggaa       540
     gttgtgcgat ggacgaagct gcggaagatc accgggcagg cgttctcgga aatcgggaag       600
     cgcaatttcg gacggccaac ttgccttgcg gtatccacgt ctattgtaat aggcacgtcc       660
     aagggtatta ttctcgtgtt cgactatcag caaagcctga agactattat tggaacgggt       720
     acaccagccg ttgagtgtgg tgctgttaca tctctagcac tttccgcaga ccattctacc       780
     gttgctgggg gtcatgactc gggcgatatc tttacctggg aaatttcgcg ctcagcaaag       840
     cctttccttc atatcccgcc aatcccggcc aatcaaaccg agactagaat atctgatggt       900
     catctttcag gatctgcggt cattcatatc ggctttcttg gcaccagacg aaccgcgctg       960
     gtctcggctg acacacgggg catgtcgttc tcacacctgg caacaagagg aatgggtgca      1020
     gtagggcgaa cagtcaagac cactcgaatt ctaggtcgat atccccaggc agcggcagag      1080
     gtcaagcggc ggaagcctag ctctgttctt gctttctctc ctctgccact cggcaacgta      1140
     gagcaaccca ccgattcttt gggcctcgtt gctatgctga caccctatct tcttgttatt      1200
     gtgtccacca caccagtggc acaaacccag cacaaagcac cgagacccaa agaagttccc      1260
     gcgcacagtg ctttgaccgg cgccttggca tggtttccag ctattcgact gaagggaaaa      1320
     gacacccaaa cttcaaacac gaagcttgtc tactgctggt caaatgtttt gactgttctc      1380
     gaagtctcag aggccgagtc ggacgaacct gcagacaaag acaagcctcc cagtcttgtc      1440
     ttcagagcgc gcagcagatg gagagcagat gaagccattg tggctgttca gtggctcagt      1500
     cgttcagtgc tcgcggtgtt cacaataacg cagcggctac tcataatcga ggattattcc      1560
     atgcatgtta ccgactcagt cgatctcgcc aacagacaca tatatcacac tgatctcttc      1620
     tcgtcacagc ttcattcgct agttgaacag cttgacgagg aggatgactc gatgcatgga      1680
     gtagtagcag atgcattcca tatgagtttc cgttcttata aagggcgctt gttcttgctt      1740
     ggttataacg aagccctggt aggcaatctc tcaaattggg ccgatcgctt gctggcgctt      1800
     atggaggccg gtgacttcat tggggccatt cgactagcaa cttcttacta tacgggcgaa      1860
     tcggaaaagc tgacggttgg gctcccggaa gaggatgttt tgcgacagcc cattgtgcaa      1920
     gaaaagcttt tggaaatgat ctccgcatcc ctcaagtatg cttttggtcg aaattccgaa      1980
     gcaagcaatg gccgactaga gaaccagcag ctggaggagc ttgcagaagt ttctatcgcg      2040
     gcctgtgtct acatgagcga cgaagagttc ctatgggagg aagtcttcaa ctggtatgag      2100
     gagcaagatt cggcgggcat tttcctggat gccctcgaac cacgcatcgt cgatggaact      2160
     ctgcgatcac tacctccgat cgcggtcaag gcgttgatta accatttcat tggaactcac      2220
     tcggccggtc gcttggagga gatcatctgt cttcttgata ctaccacaat ggacatcgat      2280
     caagtcacca cgctgtgtaa gcagcacaat ctttacgatg cctttatata tgtatggaac      2340
     cgctgtttga tggattatgt tggaccactg gaagaactac tacatatgat tccttcccag      2400
     cctcagccct tggtcaacgg tgactatgcg attgaaatga gacggcagaa caatgcgatg      2460
     aagatgtttc cctatttgtc atttatcttg actggtcgca tctatcccac cggagacgac      2520
     atggatgagg ctgaagccac acgagccaaa acagacttgt accaattcct cttctctggc      2580
     cgtgtgtcag gtacggtacc tggagatacc aacgaggcag actccttctc tcagcttcga      2640
     gccatgctca agtttgatgc ttccagcttc atgagcatgc tcaacgaggc atttgaggac      2700
     agcttcctaa atgagcctga gagcgaggat atctcgacgt cggacatgtt gatcaatcgg      2760
     cagtacctcg tcagcatttt gctgcaagtc atgaccggcg atcttttcac gccttttgat      2820
     atcatctacc tggatatgtt tgttgcgcgc aatcttccta aatatcctca gtatattctc      2880
     ctttctggca caaccctcca tcaggttctg gtgcgtgtat gccaatatcc cgagcaggaa      2940
     atggcagagg attgcgaatt gagtgcagag tatctgctgt ccttttatca cccaccagat      3000
     atccagagca tgatccctct atttaaagag gcacgctttt tccggattct caagtcgacc      3060
     taccgctcgg agaagcaata tcccctgttg gttatgactt acctggagga tccgagcgac      3120
     cgcgacgcta tcttcacctg cctacaggac tgcctccgtc caagctccgg gcttggcaag      3180
     aaacagagac gcgatgtagt ggacgtagtc aaggagcatg cccgggagat agctgcaatt      3240
     gatgtgacgc acgctgcacg gacgatgcaa gacctggccc cggacacaca ctctacgttt      3300
     ttgcgggttc tagaagacga tccccagaaa cagtatcagt acttgctagt cctagtcgag      3360
     ccgcaggctc aaactgcaga caccagatat tcgcccggtg ttgaaaactg gatgatcgag      3420
     cgctacgtgc agctcttgtg caaatacaac ccgtctcatg tcgcagattt cgttgacgga      3480
     ttgcgagtcg gtgacatcca cctggaggaa ctgctcccat ccatcgagga aagcggagcc      3540
     atcgatgctg ccgtcatcct cctcgcccga cagggccaag tccgcgaggc ccttgaccgt      3600
     cttgtcgcgc acttgggcac cctcgaatcc ggtctggtag gcattctcca gagcgtgcgc      3660
     gatagccccg actcagcgac tactgccgag gcaatcgacg acttgatcga gtcactgaac      3720
     aagtatgctg gcgtcggaac gtggctctgc cagggccaaa ctaagacagc caagcagtct      3780
     cgcacaggaa gcaccaacgg caaacgcaat gcgccaaccc ttgaccagcc tctagccttc      3840
     gacgaactcc tctggctcga ccacatcgaa gccgtggtcc gcatcgcaag caatgtcttc      3900
     gccttcatac aagggaacaa cgcccaaata agcctccccg cccaaccaac agactccctc      3960
     gctggcgaaa gcggccgcct aacaacagcg ttccgtgccc tcgtccagca agtcttcaca      4020
     gccctcctag caagcacagt aaaaagcagc ccaaccacaa ccgaacgaac agacatatcc      4080
     ttcctccgca ttctacgcgc attcctcacc cgcgccgcaa cctggtcccc ctccctcctc      4140
     gagctgcgcg ccgtgctagc ctccattttc tccgcctact cctacgagaa atctctccta      4200
     accctcgcaa acggcatgct tgaccgcgac ctcttcgtcc acgtcgacga agtctcccgt      4260
     ctacgccagc aaggctggcg gccccgcggc cacgtctgcg aaatctgccg cagccgcatc      4320
     tggggcccca gcgttggcga agcgcattgg tccacatggg aagcgcgacg cgccgaggtc      4380
     tacgcccatc gcatcgcgag gcgcaatgag gacggctaca acccgtccga ccgcgggaag      4440
     ggcaaggctg ctgatgtcgg agttggtcat atgtcccatc tagatgcggg cggtgcgcat      4500
     ggacacgcac atgtcctcgc tcatcgcgag catggcgatc gtggtggtat gtctggtgcg      4560
     aacgctgacc atgatcacga gcattgccac gctgaggctg gggcaggatc tagcactgcg      4620
     actacagtcg cagacagccc cccagaaccc gttgtcgttt tcgcctgccg acacctctac      4680
     caccgacgct gcgtgctgga cgctatcagt gccagggccc gacccgctga gaccgcgttt      4740
     cggcgcgacc atttgcccga ctggacaggg gccgagctgt tctgcccgac ctgtacatag      4800
//

If you have problems or comments...

PBIL Back to PBIL home page