(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE347

PENCW_10.PE347       Location/Qualifiers
FT   CDS_pept        complement(813346..814896)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950868"
FT                   /orf_name="Pc13g03470"
FT                   /product="Pc13g03470 protein"
FT                   /protein_id="CAP91416.1"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI0001830513"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z8"
FT                   /transl_table=1
FT                   /translation="MHRVPRLTRPIYIRSIQSTVIQRSRLSQRTQPSRKLDSAKMFQPY
FT                   NLTPLDQLSPPGHFTMSLTFNLVGKNRVEALQRMEDAGSCVFSKFPFLSGMVVPSTQRD
FT                   GKSNALQVRPSTAAELEECPIIVTQHHTEPTAITVDGKFNTSLMPFPVVSPPRNPSPVL
FT                   RLKAHVIEDNVHLVLCFDHRVMDGSGIFALFRTFSSFCRDLNATGPFTTTQAQEEIRQH
FT                   IEQVASTATPRDVQWTSLPTTTSEDKVPTDYGRVPIGSSHVFDAQKINILLDACNSTLQ
FT                   SLPEKYRKDLSETSLRPGLLVSALLGICSNRARLRAFPDEPHLSSDMFIVENLRKALNL
FT                   RRGYLGSTIGATQVKCDGYAHPPPESLQNIHVPESLSPVGAEDMWRVCNVAQSLQEVSG
FT                   RLDKEYTEGIIARMSREQDWSSFRPGWGVNFLVSDIKSAKPYGNFGPLGDLELFDLHFD
FT                   TQPGYCWIMPNLPSDTASPYPCWRLRWILERAAMECLSNDPLFQWASTPSTASTHAEV"
     atgcatcgcg tcccccgctt gaccaggcct atctacattc gctctataca gagtaccgtc        60
     atccaacgaa gtcgacttag tcaaagaacc caaccttcga gaaaattgga ttctgcaaag       120
     atgttccaac cctacaacct tactccgttg gaccaacttt cacctccggg gcattttact       180
     atgtctctca cgtttaattt ggttggcaag aaccgcgtgg aggcccttca gcgaatggag       240
     gatgcaggat cttgtgtgtt ctccaaattt cccttcctga gtggcatggt agtaccctct       300
     acccagcgag atggtaaaag caacgcactt caggtgcggc cttccaccgc tgccgagctt       360
     gaagagtgcc ctattatagt cactcaacat catacggagc ccaccgcaat caccgtggat       420
     gggaaattca acacttcctt gatgccgttc ccagtcgtct ccccaccacg taacccttct       480
     cctgtgctac ggctgaaggc tcatgtaata gaagacaacg tacacctggt cttgtgtttt       540
     gatcaccgag taatggacgg gtcagggatc ttcgctttgt tccgtacttt ctcctcattc       600
     tgtcgcgatt taaatgccac gggtccattc acaactacac aagcgcagga agaaataaga       660
     cagcatatcg agcaagttgc atctacagcc acaccgcggg atgttcaatg gacgagcttg       720
     cctaccacaa caagcgaaga taaagtaccc acagattatg gtcgagtgcc catcggttct       780
     agtcatgtat tcgatgccca aaagataaac atactgctcg acgcctgcaa ttcgacctta       840
     cagtctcttc ccgagaagta caggaaggat ctttccgaga cgtctcttcg accgggtttg       900
     ctcgtcagcg cgctgctggg aatttgtagc aaccgggccc gcctgagggc tttccccgat       960
     gagccgcacc tctcatccga tatgttcatt gtggaaaatc ttcgaaaggc actcaattta      1020
     cgtcggggat atcttggcag tactatcggc gccacccaag tcaagtgtga tggctatgcg      1080
     catcccccgc ccgaatcctt gcaaaatatt catgtcccgg agtctctcag tccggtaggg      1140
     gcggaggata tgtggcgggt ctgcaatgtt gcccagtctc ttcaggaagt atccggacgc      1200
     ctggacaagg agtatacgga gggaataatc gcaaggatgt cccgcgaaca agattggagt      1260
     tcattccgac ctgggtgggg agtgaatttc ctcgtatctg atatcaagtc agcaaagcct      1320
     tatggaaact ttgggccact cggagatctt gaattgttcg acttgcattt cgatacacaa      1380
     cctggttatt gttggataat gcctaacctt ccgtctgaca ctgcatcgcc gtatccatgc      1440
     tggagattgc gatggatttt ggaaagagcc gcgatggagt gtctttcgaa cgatcccctc      1500
     ttccagtggg cttcaactcc tagtacagcc tccacacacg ccgaagtcta g               1551
//

If you have problems or comments...

PBIL Back to PBIL home page