(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE348

PENCW_10.PE348       Location/Qualifiers
FT   CDS_pept        join(816456..817017,817074..817435)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190226" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950869"
FT                   /orf_name="Pc13g03480"
FT                   /product="Pc13g03480 protein"
FT                   /function="phosphoric diester hydrolase activity "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP91417.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008081"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniParc:UPI0001830514"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Z9"
FT                   /transl_table=1
FT                   /translation="MLAVSGTDTLVQRASQSSAYMSSPSMSTRAATCNGHSEYCTRSYS
FT                   NITFIGSHDSAFVGPLPQQNQNIDIEAQLDMGIRYLQVQTHRSVIDENVIELCHTSCLL
FT                   EDAGPLKEYLETIKNWLDANPNEVVTLLLTNGDSVPITEFGDTFSSSGISNYAYVPSEN
FT                   PLSITDWPTLGDMISSGKRLVVFLDYGADTTKVNFIQDEFAYYFETAYGVTDASFPNCS
FT                   IDRPSGAAATGRMGIVNHFLDVDVLGIKIPARHEADNTNAATGPGSIGAQAALCAGLYG
FT                   YAPNVVLADFVDKGDVITAQKNLNGL"
     atgctggcag tgtcagggac ggacacatta gtacagcgag catctcagtc ctcagcatat        60
     atgtcttccc catcgatgtc gactcgagcc gcaacatgca acggccactc agagtactgc       120
     acccgctcct actcgaatat tacatttata ggctcccacg actccgcctt tgtcggaccc       180
     ttaccccaac agaaccaaaa tatcgacata gaagcccaac tcgacatggg gatccggtac       240
     ctgcaagtgc aaacacaccg ctccgtcatt gatgagaacg tcatagagct gtgccataca       300
     tcatgcttgc ttgaagatgc aggacctctc aaagaatatt tggagactat taaaaactgg       360
     ttggatgcaa atccgaacga agttgtcact ctcctcttaa caaacggaga ctcggtacca       420
     atcaccgagt ttggagacac cttctccagc agcgggattt ccaactatgc ctacgttccc       480
     tccgaaaatc cgctatcaat tacagactgg cccacactgg gtgatatgat ctccagcgga       540
     aagcgattgg tcgtatttct ggactacggc gccgacacta caaaagtgaa cttcattcaa       600
     gatgagttcg cgtactactt cgagacagcc tacggtgtca cagacgcctc tttcccgaac       660
     tgcagcatcg accggccctc tggtgctgcc gcgacgggcc gtatgggcat agtcaaccac       720
     ttccttgatg tcgatgttct aggcataaag attccagccc gccacgaggc agacaatact       780
     aatgctgcga cggggcctgg tagtattggc gcccaggcgg cactatgtgc cgggctgtat       840
     gggtatgcgc ctaatgtggt gctggcggac ttcgtagata agggggatgt tattacggcc       900
     cagaagaatc tgaatgggtt gtag                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page