(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE349

PENCW_10.PE349       Location/Qualifiers
FT   CDS_pept        complement(817740..819095)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234623" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950870"
FT                   /orf_name="Pc13g03490"
FT                   /product="Pc13g03490 protein"
FT                   /protein_id="CAP91418.1"
FT                   /db_xref="UniParc:UPI0001830515"
FT                   /db_xref="UniProtKB/TrEMBL:B6H200"
FT                   /transl_table=1
FT                   /translation="MKVLKSVALASLLSFTGFGQHAFASSSLKKPILHDFDDDGVDGGL
FT                   YRPSVAGPKSRIAVYIMHAEQDYTSFVACEALQERGFTVFCANNDASKSGYMSDLNFED
FT                   MMTNVNQGMTYLRNLTDIDKVVILGHSGGGAMMAAYQDIAENGASACQGSEKIYPCSDE
FT                   MDDLEPADGLILLDANYGLSTMAFLSLSPAIIDESSPSKINETLNVFNPANGFNNTRSN
FT                   YTAEFKKAFQSGAVARNNRIIKHAQERLAAIEAGNGTYSDDEPFTVPASLYIGFNNLFF
FT                   AQDTRYLAHTTHAWPLLHKNGTTTQVVRSVRVPANFKSFADQWEGGALKTTVKRYLSTF
FT                   AIRVGDDYNLRADGIDGIDYASSNLAPVASIRGVSVPLLTMGMTGHYEYLNAEKLHLAA
FT                   GSNDTTIAFVEGAQHTIDTCTACESFPGEFGNTVVTCFNHVENWLAKKGRFI"
     atgaaggttc ttaagagtgt agctcttgca tcccttctat cttttacagg ctttggccaa        60
     cacgcattcg catcgagctc tttgaaaaag ccgattcttc acgactttga cgacgatggc       120
     gtcgatgggg gactttaccg accttctgtc gctggaccga agtcacgtat cgccgtctac       180
     ataatgcatg cggaacagga ttacacttcg tttgtcgctt gtgaagccct tcaagaacgg       240
     ggcttcaccg tgttctgtgc aaacaacgac gctagcaaaa gtggatacat gtcggatctc       300
     aacttcgagg acatgatgac caatgttaac cagggcatga cctatctgcg caacctaacc       360
     gatatcgaca aggttgttat tcttgggcat agcggtggtg gtgccatgat ggctgcctac       420
     caagatattg cagagaatgg tgcttcagcc tgccagggct cggagaagat ctacccatgc       480
     tccgacgaaa tggacgatct cgagcctgct gatggcttga tactcctgga cgccaactac       540
     ggcctttcca ccatggcatt tttgagtttg agccctgcca tcatagacga gagcagccca       600
     tccaagatca acgagacgct aaatgtgttc aaccctgcca acggtttcaa caacacccgc       660
     tccaactaca cggccgaatt caagaaggct ttccagagtg gagctgtggc ccgcaacaac       720
     cgcatcatca agcatgccca agagcgcctc gcagctatcg aagctggaaa cggcacttac       780
     tcggatgatg agccttttac tgtcccggca tccctgtaca ttggtttcaa caatctattc       840
     tttgcccagg atactcgcta tctcgctcac accactcacg catggcctct actacacaag       900
     aacggaacca ctacccaagt cgtccgctcc gtccgtgttc ccgccaactt caagtctttc       960
     gccgaccaat gggagggcgg tgcccttaag accaccgtca agcgctacct ctcgacgttt      1020
     gccattcgcg ttggagacga ttacaacctc cgcgctgacg gtatagatgg aatcgactat      1080
     gcttccagca accttgcgcc cgtcgcttct atcaggggcg ttagtgttcc cctgctcacg      1140
     atgggcatga ccggtcatta tgagtacctt aatgccgaga agcttcacct agctgctggc      1200
     agcaatgaca ccaccatcgc ttttgttgag ggtgctcagc acactataga cacttgcact      1260
     gcttgcgagt ctttccctgg agagtttgga aataccgttg tcacttgctt caaccatgtt      1320
     gagaactggt tagccaagaa aggccgtttt atttag                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page