(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE35

PENCW_10.PE35        Location/Qualifiers
FT   CDS_pept        join(82534..82708,82894..83639)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977821"
FT                   /orf_name="Pc13g00350"
FT                   /product="Putative uncharacterized protein Pc13g00350 "
FT                   /protein_id="CAP91104.1"
FT                   /db_xref="UniParc:UPI0001830DC7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H180"
FT                   /transl_table=1
FT                   /translation="MMKPQDNYCQLLMPQNYLYTIKHGIPQGGLAVIATFIFWSTARRV
FT                   ANAHRTSQYYRAKILLKTFPWKPVTPYRAPKQNPMDSVTPRKKDNEDHSVFLSSVAPIE
FT                   LSLTTSLQLPKEASNVGIPELDARGLSKQNNLETTFPQWQTKRAVHSKRENESTLHRTS
FT                   EKRTENSCRRNRVRKSSLGQHGSKASQCISSASFKNRTLSKAMKLGPITYRGALKMTGK
FT                   LCKAQLPLLKNHFRDRSDLFSDGEALLHEIATVHPKYNQIIQTLPILLNFIPGELKEKL
FT                   MIEENAEWLKMGAYLVNKWISRSQA"
     atgatgaaac cacaagacaa ttactgccaa ctattgatgc ctcagaatta cctttatacg        60
     attaagcacg gcatacctca gggagggcta gcggtgatcg caacgttcat tttctggtca       120
     accgctagaa gagtggcaaa cgcccatcgt acatcacaat attaccgggc gaaaattctc       180
     ctcaaaactt tcccctggaa gcccgtcaca ccgtatcgag ccccaaagca aaacccaatg       240
     gattctgtta caccaaggaa aaaagataat gaagatcatt ctgtgtttct gtcttctgtc       300
     gcgccaattg aattatccct aactacttca cttcaacttc ccaaagaggc aagcaatgtc       360
     ggcattccag agctggatgc cagaggcttg tcaaaacaaa ataacctaga aacaacattc       420
     ccccagtggc agaccaagcg ggccgttcac tctaaaagag agaatgaatc cacactacat       480
     cgcactagtg agaaacgcac cgagaattcc tgcaggcgaa acagagtgcg aaagtcttca       540
     cttggtcagc acggctccaa agccagccaa tgtatttcat cagcctcatt caaaaacaga       600
     acattgtcta aggcaatgaa actgggtcca atcacttacc gcggcgccct aaagatgact       660
     gggaagcttt gcaaagcaca gttgcccctc cttaaaaatc acttcagaga tcgcagtgat       720
     ctatttagcg acggagaagc cttgctacat gagatagcaa ctgtgcaccc aaaatacaac       780
     cagattattc aaaccctgcc catcttactg aattttattc ctggggaact taaagaaaaa       840
     ctgatgattg aagaaaacgc ggagtggttg aagatgggag cttatttggt caataaatgg       900
     atttcaagat cacaagcatg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page