(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE350

PENCW_10.PE350       Location/Qualifiers
FT   CDS_pept        join(complement(821218..821412),complement(820806..821151),
FT                   complement(820605..820725),complement(820323..820524))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000063755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950871"
FT                   /orf_name="Pc13g03500"
FT                   /product="Pc13g03500 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91419.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniParc:UPI0001830516"
FT                   /db_xref="UniProtKB/TrEMBL:B6H201"
FT                   /transl_table=1
FT                   /translation="MSLNWTNLIRFISEEDGQIHLGEVDTRKYPDIGLTVLNGERVAVN
FT                   LVKGSIFDGVVTETIMHVGRLLAPIGIEEVPIIRCMGLNYRDHATEANMPIPDVPVLFI
FT                   KPRTALNGPYPAKINVPKIAQDGSSDYEAELSIVLSKSGRDIPESEAMDYVLGYTCSND
FT                   VSARTQQFKNSQWCFSKGLDGSCPIGPVLVSPSVVGNPHNLRIKAIHNGTVVQDSNTRE
FT                   MIFDIAKTIAFLSQGTTLERGTIIMTGTGPGIGVMRNPKVVLNDGDDMRVEIENIGTLI
FT                   NKVHYE"
     atgtctctca actggacaaa tcttatcagg ttcataagcg aggaagatgg acagatacat        60
     cttggcgaag ttgatacgag gaagtatccg gacattggac tcactgtatt gaacggcgaa       120
     agagttgcag ttaacctggt caagggatca atcttcgatg gcgttgtaac cgagaccatt       180
     atgcacgttg gacgactttt ggcccccatc ggaatcgagg aagtgcccat catccggtgc       240
     atgggactca actaccgcga ccatgctaca gaagcaaata tgccaatccc agatgtgccg       300
     gtcctcttca tcaaaccccg tacggcactc aacggaccct acccggccaa gatcaacgtg       360
     ccgaagatcg cacaggacgg ttccagtgac tacgaggcag agctttccat cgttttgtcc       420
     aagtcaggcc gagacatccc cgaatcggag gcaatggatt atgttttggg atacacctgc       480
     agtaacgatg tcagtgctcg gacgcagcag tttaagaata gccaatggtg cttctcaaaa       540
     ggtcttgacg gatcctgccc gataggccca gttcttgtat ctccctctgt cgttggaaat       600
     ccgcataatc ttcggattaa agcaattcac aatggcacgg tagtacagga ttcaaatacc       660
     cgggaaatga ttttcgatat tgcaaagacg atagcattcc tatcccaagg tactactctg       720
     gaaagaggca ctattatcat gaccggaaca ggtcctggca ttggtgttat gcggaaccca       780
     aaggttgttt tgaatgatgg tgatgatatg agagtggaaa ttgagaatat tgggactttg       840
     atcaacaagg ttcactatga gtga                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page