(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE351

PENCW_10.PE351       Location/Qualifiers
FT   CDS_pept        join(complement(822885..823305),complement(822604..822711),
FT                   complement(822298..822532),complement(822129..822238),
FT                   complement(822041..822072))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000221402" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825156"
FT                   /orf_name="Pc13g03510"
FT                   /product="Pc13g03510 protein"
FT                   /protein_id="CAP91420.1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="UniParc:UPI0001830517"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y7"
FT                   /transl_table=1
FT                   /translation="MTVNITPRINLVRIAHVFYTYKDLNKAHEFLLDFGFQEVKRAGKD
FT                   IYYRGTSSQPFVYCARHGEEDVFGGAAFVVESEADLVASQELPGATEIYGLSDAPGGGR
FT                   CVTFHDPIDDFPFHLVYGQTHWADEKALPQLNFNFVSPAPVHKIGHFGTCVTDFAKAFD
FT                   FYTTRFNFKPSDVYSTGKDITTFLHLDRGSELVDHHCFFFFEGPKPHVHHSSFETHDFD
FT                   TQVLGHDWLRSKGYQNCWGVGRHIMGSQIFDYWFDPSHFIIEHYVDGDLVNDEYPINRS
FT                   LASPGNLHVWGPDLPPTFLQ"
     atgaccgtga acatcacacc tcggatcaac cttgttcgca tcgcccatgt cttttacacc        60
     tacaaagacc tcaacaaagc ccatgaattc ctactagact ttggcttcca ggaagtcaaa       120
     cgtgcgggca aggatatcta ttatcgcggc actagttccc agccatttgt gtactgcgcg       180
     cgacatggtg aagaagacgt gttcgggggc gcagctttcg tcgtggaatc tgaagctgat       240
     cttgtggcct cgcaagagct acctggagct acagagatat acggattgag cgatgcgcct       300
     ggcggtggtc gctgtgtcac tttccacgac cccatcgatg atttcccttt ccaccttgtt       360
     tacggacaaa cacactgggc cgatgaaaag gctctcccgc aactcaattt caatttcgtg       420
     agccccgccc cagtgcacaa gataggtcat tttggaacgt gtgtcaccga cttcgccaag       480
     gcctttgact tctataccac ccgattcaac ttcaagccga gtgatgtata ctctaccgga       540
     aaagacataa ctacattcct tcatttagat cgtggttctg aattggtcga tcaccattgc       600
     tttttcttct ttgaaggtcc caagccgcac gtacatcact cgtcgtttga aacacatgat       660
     ttcgacactc aagtgttggg tcatgactgg ctgcgcagca aggggtatca gaactgctgg       720
     ggtgtaggac gtcacatcat gggaagtcag atctttgatt actggttcga tccctctcac       780
     ttcatcatcg aacattatgt tgatggtgat ttggttaatg atgagtatcc catcaatcga       840
     tcccttgcct cgcctggcaa tttgcatgta tggggcccgg atcttccccc caccttcctg       900
     cagtaa                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page