(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE352

PENCW_10.PE352       Location/Qualifiers
FT   CDS_pept        join(complement(826118..826181),complement(825568..825955),
FT                   complement(825134..825499),complement(823622..825086))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076579" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978322"
FT                   /orf_name="Pc13g03520"
FT                   /product="Pc13g03520 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91421.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001830518"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y8"
FT                   /transl_table=1
FT                   /translation="MVCQGFDKGISICSKAHEVTSGSLQKRRKCRRSEDTAQSRHLHLQ
FT                   SNSYNPNLCSDNNDLDVLNDESETEGLVPTDYAETVHRTKTDEGGKTQTSHLNMHDLSY
FT                   ILHPSHESTIPNPDRNRSACSNDGEKGGVRRQACAELGVSQSAMNQMIRAFFENMVAIN
FT                   IFHEPSFAEKLSNISSLCQLSALLAAIAAYSSRFIGSGTNISSLGEHRTAGKSQQQPEY
FT                   FVGLAFNYVNKALVACDDETPSLCILQALIIATHCQLTRGVRGKAWRSLGLGVAKPDNI
FT                   HQWQADEEKRRAFWAVWEMDVFASTIRQAPTAIDWGHMEILLPVDNANWFLGRPSSSCF
FT                   MDADPNQSWKALQDSGNQSPKAWFLVINSFMKIAHSISDPRRLSAMDNAGHYQPGHPTP
FT                   GLDEERCWKLEKLGNAVRCFNMALPSHLRYHDQYLAFGAPVQGRLESQRQQHCSLYNIF
FT                   VMTQLVWLMIHRHDAFRPQTRQAETNHFYPPGDGVVAGGVISSSHETECTAQRQYYDAA
FT                   DRILRIVSQSCEDHIQHISPFLSSTFWLVSAVQLVRKHFTREPANRSLIESRFDVVYMT
FT                   YRRCVEFWGTQTAMQRNLESLEEQLEARKRKMNSHESQASSAHQTSHIERHTKRKRTHQ
FT                   TVSRTTEQDYLPHLPTGRSVRNNLPEYIPETPIPLEASALPVGDSQSYVRQHPAAVDSM
FT                   AMVDMMLPPQSDRGHSSGTCMMPTSSDYFDPTVLNLGDVHDDQILDLRDFDLSGGIQDL
FT                   LAEWITY"
     atggtatgcc aaggattcga taaaggaatt tccatctgct ccaaagctca tgaagtaacg        60
     tctggctctc tccaaaagcg gagaaaatgt cgccgttcag aagacacagc ccaaagccgc       120
     caccttcacc ttcagtcgaa ctcatacaac cctaacctat gttcggacaa taatgatctc       180
     gacgtcctca acgatgaatc tgagacagaa gggctggtcc ccactgatta tgcggagaca       240
     gtgcatagaa cgaagacaga tgaaggtggt aaaactcaaa cttcgcatct aaatatgcac       300
     gatctttctt acatactcca cccatctcat gaatcgacaa ttcccaaccc cgatcgaaac       360
     cggagcgcgt gctctaatga tggggaaaaa ggcggggttc gccgtcaagc ttgcgcagaa       420
     ctaggtgtgt cacagtctgc gatgaatcaa atgattcgag ctttttttga aaacatggtc       480
     gccatcaata tctttcatga accttcattt gcagaaaagc tttcaaatat ttcttctctg       540
     tgtcaactga gtgccctgct tgctgccata gctgcgtatt cctcacgttt catcggctcc       600
     gggacaaata tttcatctct cggtgaacat cgtactgcgg gcaaaagtca acaacaacct       660
     gaatatttcg ttggccttgc cttcaattac gtgaacaagg ctcttgtggc atgtgatgat       720
     gagacgccat ctctttgcat tctccaagcc ctcattattg caacgcattg ccaactcact       780
     cgaggggttc gcggaaaggc atggaggtct ctggggctag gggttgcaaa acccgacaat       840
     atccaccagt ggcaagcgga cgaagaaaag cgccgtgcct tttgggcagt ctgggaaatg       900
     gatgttttcg ccagtactat tcgtcaggca ccaaccgcca ttgactgggg acacatggag       960
     atcctcctgc ctgttgataa cgccaattgg ttcttgggcc gccccagttc aagctgcttc      1020
     atggatgctg acccaaacca atcttggaag gcgctccagg atagtggcaa tcagtcccct      1080
     aaagcatggt ttctggtaat aaactctttc atgaaaatag cccacagcat ttctgacccc      1140
     cgacggctat ctgctatgga caatgcgggc cactaccagc ccggtcaccc taccccggga      1200
     ttggatgagg agcgttgctg gaaattggag aaactgggga acgcagtacg ttgctttaat      1260
     atggctctac caagccattt gcgttatcac gatcagtatc tggccttcgg cgcgccggta      1320
     caagggcggc tggagtctca acgacagcag cattgctctt tatacaacat attcgtcatg      1380
     acacagctgg tttggttgat gatccacaga catgacgcat tcagacctca aacccgtcaa      1440
     gccgagacca accatttcta cccgcccggg gatggggttg tggccggtgg ggttatatcc      1500
     agctcacatg agactgaatg tactgcacaa cgacaatatt atgacgcagc cgatcgcatc      1560
     ttaagaattg tgagtcaaag ctgcgaagat catattcagc acatctctcc gttcctttcc      1620
     agcaccttct ggcttgtctc ggcggtgcag ctagtccgaa aacactttac tcgagagcct      1680
     gcaaatcgaa gcttgattga atcgcggttt gacgttgtgt acatgaccta caggcggtgc      1740
     gttgagttct ggggcaccca aaccgctatg cagcggaatc tggagtcgct cgaggagcaa      1800
     ttagaagcca ggaaaagaaa gatgaatagt catgagagcc aagcttcgtc agcccaccag      1860
     acgagccaca ttgaacgcca tacgaagagg aaacgaacgc accagaccgt gtcacgtacc      1920
     acggagcagg attatctccc ccatcttcca accgggagaa gtgtcagaaa caaccttcct      1980
     gaatatatac cggaaacacc cattcctctc gaagcctcag cattgcccgt tggcgacagc      2040
     cagagctatg ttagacagca cccagctgcg gtagatagta tggcgatggt ggacatgatg      2100
     cttcctccac agtccgatag gggccatagt agtgggacgt gtatgatgcc tactagctct      2160
     gattattttg atccaacggt cctaaatttg ggtgacgtcc atgatgatca gatcctggat      2220
     ttgcgcgact ttgatctttc tggtggcata caggatttgc ttgctgagtg gatcacatac      2280
     tga                                                                    2283
//

If you have problems or comments...

PBIL Back to PBIL home page