(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE353

PENCW_10.PE353       Location/Qualifiers
FT   CDS_pept        join(complement(827736..827742),complement(827346..827574),
FT                   complement(827132..827267))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825157"
FT                   /orf_name="Pc13g03530"
FT                   /product="Putative uncharacterized protein Pc13g03530 "
FT                   /protein_id="CAP91422.1"
FT                   /db_xref="UniParc:UPI00018305DC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y9"
FT                   /transl_table=1
FT                   /translation="MIAIDKFFKYVVFPDLKTVMNQLLDFILSDRRLQIDFDHATYKSI
FT                   VKALRGQNNFMDLAFEAILPEIKGFQGKLITTQDLHKDSPNTIVEFGISKEPEYVASSA
FT                   IRDSEISDQDDLMDLPRPR"
     atgattgcta ttgataagtt ttttaaatat gttgttttcc ctgacctaaa gacggttatg        60
     aatcaactcc ttgattttat actatcagat cgacggcttc aaattgattt cgaccatgcg       120
     acttataaga gcatagttaa ggctcttaga ggacaaaaca acttcatgga tttagcattc       180
     gaggcaattt taccggagat caaaggcttc cagggcaagc ttattactac gcaagatcta       240
     cataaagatt cgcctaatac aatcgtcgag tttggaattt caaaggaacc ggagtatgtc       300
     gcctcgagcg ctattcgaga ttcagagatc tcggaccaag atgacttgat ggacctgccc       360
     cgtcctcgat aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page