(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE355

PENCW_10.PE355       Location/Qualifiers
FT   CDS_pept        complement(831174..832496)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950873"
FT                   /orf_name="Pc13g03550"
FT                   /product="Putative uncharacterized protein Pc13g03550 "
FT                   /protein_id="CAP91424.1"
FT                   /db_xref="UniParc:UPI00018305DE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U6"
FT                   /transl_table=1
FT                   /translation="MPPKSSTRKGGKKGMSHTLSPDPSSSPIRKKQKGTPSAIRDRANS
FT                   SSRSGIPKLEPSSGAHPPSEYWNQLTDFQRDFLDGAMQETVSNLYDLGAEIKAETSSPA
FT                   PSSIINDENESQYSLGTPVPGPIPAPFPYTVDDLTLCHAPTADPTGYPIFVSRNGRWDW
FT                   YYLSSNTKTTETPANGTSNGNTTNTKSEFANDLCLSPNQFPCTKDDTTLCPCPNPGPNS
FT                   AYSPTFSSQNGRWEWIFLPSNTDTESSPPKVKMEDIPEANPRVQRPSNPLSTTFSATDL
FT                   DHFVFHGLQDSDDDENIIERARTENIELAKTVKHVKFFMNNSHDKHFVPFQVPALIGYE
FT                   NWEPWLAGMYLLFRQHSVWPVVTAELEPLPPGHNLHLWYNRMLDCAVALIYANVSDVVR
FT                   NTHCLMSTLHDDDPDELMAHLYAHYAEPDLTHPPHEESELD"
     atgcctccca aatcttccac ccgtaaaggc ggcaagaagg gtatgtccca tactctgtcc        60
     cctgatccat catcatcgcc catccgaaag aagcaaaaag gtacaccatc ggccatccga       120
     gacagagcta acagcagctc ccgatcagga attcccaagt tggaaccctc ttccggagcc       180
     catcccccaa gtgagtattg gaatcaactt acagactttc aacgggattt cctcgatggc       240
     gctatgcaag agacagtctc taacctttat gacctgggcg cagagatcaa agctgagacg       300
     tcttctcccg ctccctcttc catcatcaat gacgagaacg agagtcagta cagccttggc       360
     actcctgtcc caggcccaat tccagcccca tttccatata ccgtggacga tcttacctta       420
     tgtcacgctc ccaccgctga tcccactggc taccctatct ttgtttcccg aaatgggcgc       480
     tgggactggt attatctttc ctctaacacc aagactacag agacacctgc caatggtacg       540
     agcaacggaa ataccacgaa cacaaagagt gagtttgcaa acgacctctg tctttccccg       600
     aaccaatttc cctgcacgaa ggacgacact actctgtgtc cttgtcccaa tcctggtccc       660
     aattccgcct acagtcccac cttttcttct caaaacggac gttgggaatg gatctttctc       720
     ccctctaaca cggatacaga gtcgtctccc cccaaggtca agatggagga catccccgag       780
     gccaatccaa gggtccagcg accaagcaac cccctctcga ccacattctc cgctaccgac       840
     ctggatcact tcgtcttcca cggcttgcaa gacagtgatg acgacgaaaa cataattgag       900
     cgtgccagaa ccgaaaacat agagctagcc aagactgtga agcatgtcaa gttcttcatg       960
     aacaattccc atgacaagca cttcgtcccc ttccaagtcc ccgctctcat cggctatgag      1020
     aactgggagc cctggttggc cggcatgtat ctgctcttcc gccagcactc ggtgtggcct      1080
     gttgtgactg cagaacttga gccactgcct ccaggtcaca atttgcacct gtggtacaac      1140
     cgcatgctcg attgtgcagt tgcccttatc tacgccaacg tctctgatgt ggttcgcaac      1200
     actcattgtc tcatgagtac cctgcacgat gatgatcctg acgagttgat ggctcacctg      1260
     tacgctcact atgccgagcc tgatttgact catccccctc atgaagagtc tgagcttgat      1320
     tag                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page