(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE356

PENCW_10.PE356       Location/Qualifiers
FT   CDS_pept        join(complement(835699..835715),complement(835402..835453),
FT                   complement(835111..835349),complement(834034..835057),
FT                   complement(833765..833987),complement(833481..833713),
FT                   complement(833218..833429),complement(833003..833144))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157728" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950874"
FT                   /orf_name="Pc13g03560"
FT                   /product="Pc13g03560 protein"
FT                   /protein_id="CAP91425.1"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniParc:UPI00018305DF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U7"
FT                   /transl_table=1
FT                   /translation="MPTSSLQLIAAPRRSDAIPNPSGEVALFSTSEYSFETHATSSWWS
FT                   LLDLETGKVTQLTNDSNVSELTWLGSTDSGLLYINGTNAEIPGGTEIWVSDTSDFANSA
FT                   YKAASLPAPLSGLKTAITKSGDINFLVYGESWPNGTAYNKELVAAPLSSARIHDSIYVR
FT                   HWDTWLTTRFNAIFSGTLKKKRAGPGATSAYTSSGSLKNLVAGVKNLESPYPPFGDASD
FT                   YDISSNGKLVAFKSKAPELPRANHTASYIYVVPHDGSKKAVAINGPDSPGTPKDIKGDS
FT                   SSPVFSPDGRRIAYLQMEDISYESDRRTVYVYTIDSKDTIRTLAKDWDRSPGAIKWTAD
FT                   GKSLVLNTEDSARSRLFLLPADAGDDFKPKNFTDGGSVAAYYGLPNGEYLVSSSAIHTS
FT                   RTVYTAKPDEGVTGVIFSANEVDPALKNLDPSGVDEFYYKGNWTDIHSWIIYPSDFDKS
FT                   KSYPLLFYIHGGPQGSWGDSWSTRWNYKVFADQGYVVIAPNPTGSTGFGDKLTDEIANN
FT                   WGSYPYDDLVKCWEHVRDNFDFIDTSRGVAAGASYGGFMINWIQGNPLGREFKALASHD
FT                   GTFVADAKVSTEELWFMQHEFNGTFWDNRENYRRFDPSAPEHIKQFATPQLIIHSDLDY
FT                   RLPISEGLALFNILQERGVPSRLLSFPDENHWVINKENSLVWHQQVLGWLNKYSGIDTP
FT                   GSVNLDDTTIPVVDYNPQL"
     atgcctacta gctcactaca gcttatcgca gctccgcgac ggagtgacgc tattcccaat        60
     ccatcagggg aagtcgcgct cttttccacc tctgaatact ccttcgagac ccatgctaca       120
     tcatcatggt ggagtctgct ggatctggag acagggaaag tgactcaact taccaacgac       180
     agcaatgtct ccgaattgac ttggctgggg tctactgact cgggcctgtt gtatatcaat       240
     ggcacaaatg ccgagattcc cgggggtacg gagatttggg tgtcggacac ctctgatttt       300
     gccaactctg cctacaaggc agcttcattg cctgcgccgc tttctggcct caagacggcc       360
     atcaccaagt ctggagacat taacttcttg gtgtatggag agtcctggcc caatggaacg       420
     gcgtacaata aagagcttgt tgccgcgcct ttaagctcgg cacggatcca cgacagtatc       480
     tacgtccgcc actgggatac ctggctcacg acgagattca atgctatctt ctcggggact       540
     ttgaagaaga agagagccgg acccggagcg acatccgcct acacttctag tggatctctc       600
     aagaacctcg tcgcaggagt caagaacctg gagtcacctt accctccatt cggcgatgcg       660
     tctgactacg acatctcctc caatggaaaa ttggtggcat tcaagagcaa ggcacctgaa       720
     ttaccgcgag caaaccacac tgcttcgtat atctatgttg tgccccatga tggatccaag       780
     aaggccgtgg ctatcaatgg ccctgacagt cctggcacac cgaaagacat caagggtgat       840
     tcgagcagtc ccgtcttctc cccagatggc cgtcgcattg cctatctcca aatggaagat       900
     atctcctatg agtcggaccg tcgcactgtc tacgtttaca ccattgactc caaggatact       960
     attcgtacat tggctaagga ctgggaccgg tcacctggtg ccatcaagtg gactgctgac      1020
     gggaagagcc tggttctgaa caccgaggat tctgcgcgct ctcggctctt cctgctaccc      1080
     gctgatgctg gtgatgattt caagcctaag aacttcaccg atggtggctc cgtggctgct      1140
     tactacggcc tgcctaatgg agaatacttg gtttctagtt ccgctatcca taccagtcgt      1200
     acagtgtaca ccgcgaaacc tgatgaaggc gtcacaggcg ttattttctc tgccaacgaa      1260
     gttgaccccg ccctgaagaa ccttgatcca tcgggcgtcg atgagttcta ctacaagggc      1320
     aactggacag atattcattc atggatcatt tacccttcgg actttgacaa gtcaaagtct      1380
     tacccgctcc tattctatat ccacggtggt ccccaaggtt cctggggcga ctcctggagc      1440
     actcgatgga actacaaggt tttcgccgac caaggatacg tggttatcgc gcccaaccca      1500
     actggaagca ccggtttcgg tgataaactc acggacgaga tcgcgaacaa ctggggaagc      1560
     tacccttacg atgacttggt taaatgttgg gagcatgtcc gggacaactt cgacttcatt      1620
     gatacctctc gcggcgtggc agctggcgcc agctacggtg gcttcatgat caactggatc      1680
     cagggtaatc ctctcggtcg cgagttcaag gcgctagcca gtcatgatgg cacatttgtg      1740
     gccgacgcga aggtctcgac cgaggaactt tggttcatgc agcatgagtt caacggcacg      1800
     ttctgggaca accgagagaa ctatcgtcgg ttcgaccctt cggccccaga gcatattaag      1860
     cagttcgcta ctccacagct cattatccac agcgacttgg actatcgtct tcccatctct      1920
     gagggtctgg cgcttttcaa tatcttgcaa gagcgaggtg ttccgagtcg gctgctcagc      1980
     ttccctgatg aaaaccattg ggtcatcaac aaggaaaaca gtcttgtctg gcaccagcaa      2040
     gtcttagggt ggctcaataa gtactctggc attgacactc cgggctctgt caatttggat      2100
     gatacgacaa tccctgttgt ggactataat cctcagttgt ag                         2142
//

If you have problems or comments...

PBIL Back to PBIL home page