(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE357

PENCW_10.PE357       Location/Qualifiers
FT   CDS_pept        join(complement(837165..839109),complement(836835..837065),
FT                   complement(836240..836785))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672457"
FT                   /orf_name="Pc13g03570"
FT                   /product="Pc13g03570 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91426.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniParc:UPI00018305E0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U5"
FT                   /transl_table=1
FT                   /translation="MPPIRSQSSTNSTEQEGRILLAIQAFKNGDITSVALAARTYKVPR
FT                   TTLRHRLSGVQHRAISRANSHKLTQIEEESLEKWILSIDARGSAPRPSTIREMANLLLE
FT                   KRGTTPVLSVSDKWVYNFINRHPLLSSRFSRRYNYERAKCEDPKIITEWFNLIQKTILX
FT                   FGIDPDNIYNFNKTGFAIGLTATAKVITRSEYYGRRTLLXPRNREXVTIIECTNATSXA
FT                   LPPCMIFKGKVFIESSTASRRTSDLRLVLIDRPLMKLDFALKKLFIPTTSLRTKGGYRL
FT                   LILNGHRSHLTPRFDEICEENKIILICMPPHSSYLLXPLDIGCFTVLKRSYGRMVKIKM
FT                   RNGINHIDKLDFLEVYPLARIEAFKSETIKNSFRVAGLVPFTPERVISKLNIRLRTPTP
FT                   PPSRGSDWDPKTPSNYIQLEKQASSIKVLLRIRSKSPLSPLNSAINQVLKAYQITMQSA
FT                   ALLEKEVSDLRAENEKKKQKRTRSIRTIVHEGDLLVQEVRELRSEPFKAQVARINNYRE
FT                   RVSEGLRPPPQAGRACGICRKPGHRRETCPDR"
     atggccgatg acaggagcag gaaacaggct accctggggt atgtacggga tagacagcag        60
     acgattgggt gcgtcgacga tattcgatgg cgcatgcgcc ctttccctct gacacctctc       120
     ggttcttcct ctggttgact ccgctaattc attatatccg tgttgtagga ggtttttcgg       180
     ctcgggcgcc aaccaaccac cgaagaagca gaccacatta gcttttggtg gaaagagaca       240
     aacagcaagc agcgataccg gtgatctgga gaccaatgat aacaccgacg gaattgaggt       300
     ggaagtcgcc gccgactcag caccaactgc tgcccttaac ggaacagagc caacgaaggg       360
     tgtgaagcgg gaaaagagcg ccgaggcgga agaaagcgat gggtcagata tccaacctgt       420
     ctctaagaga cgacgaaagg cctcggtgaa gacctctcca gctgccaagg agcaatcgac       480
     atcccccaag aagcccgagt ctacaaagcc aaaggttgaa gcgccatcac caaaaccagc       540
     agtaccaaag ccctccgatg ttactcctga agagaagtca ccgtcagtag aagaagagga       600
     ggatccattg gaaagcgaag atgaagatga cctcaagccg gaactcgcga agaaatcgat       660
     cgaaaaattc caagccaaat tgcaagccag tggtaaagat ccatacccag attggaaagc       720
     aggcactcct gtcccttatg ctgcgttatg taccacattt tctctggtag agatgaccag       780
     aaagcgcttg gagatcacgg accactgttc tcttttcctt cgccaggttc ttcgtctgag       840
     ccctgccgat ttcctaccca ctgtacagct gatgatcaat aaactggctg ccgattacgc       900
     cggaattgaa ctgggcatcg gggagtcatt gatcatgaaa gctattggtg aatgtaccgg       960
     ccgcagcctt gccgtcatca aagccgatca acgggaaatc ggagacctgg gactggtcgc      1020
     tgccaaaagc aggtcaaacc agcctaccat gttcaagccc aagcctttaa ctgtacgagg      1080
     tgtgcatgaa ggccttcttg gaattgccaa ggtccaaggt catggatcac aggataaaaa      1140
     gatttcaggc atcaagaaac tgttgtctgc agccgatgcc gacacggctg gcaaaggagt      1200
     ggatattacc aaggataagg gtggtcccag cgaagctaaa tacatcgttc gctttttgga      1260
     aggtaagctg agacttggac ttgcagagaa gacggttctt gtcgctgtct ctcgggcagt      1320
     ccagactcac gaggctgaat tagccggcaa taagatcccg tccgctgagg aaatggccgc      1380
     gggtgaaaac atcttcaagt ctgtttacag cgagcttcct gcctacgaag taatcattcc      1440
     tgccgttctt gagcatggtc tcttcaagct gcctgaagtg tgcaagcttt ctcccggaat      1500
     tcctatcaag cctatgcttg ccaaaccgac caagtctatc accgaggttc ttgaccggtt      1560
     cgaagggaag gaattcactt gtgaatataa gtacgacgga gaaagagccc agatccattt      1620
     cgtgtctccg gactctatcc accaatatcc tggagctgtg aacacattac agaaggacag      1680
     caagggactg tcctcgatct tttctcgcaa ctcggaagat ctttcgaaga agtatcccga      1740
     tgttctaggc aagcttgaca cctgggtcaa gcccgacgtt aagagcttcg ttctcgattg      1800
     cgaaacggtg gcatgggata cggaggccaa aaaggttctt cccttccagc aactgatgac      1860
     tcgcaagcgc aaggatgtca aagcggaaga tgtcaaggtc aaggtctgtg tgtacgcctt      1920
     tgaccttctt ttcttcaatg gagagccttg cgtgaagaaa tctctacgag aaagacgaga      1980
     gctaatgcat aaatgcttcc aaccggttga gggggagttc cagtttgcgc aatatggcaa      2040
     ctctagtgtt cttgatgaga tccaagaatt gctcgaggct agtgttaaag cttcttgtga      2100
     gggtcttatg gtgaagatgc tggacacagc agagagcggt tacgaaccaa gcatgcggag      2160
     tcgcaactgg ctgaaggtca aaaaggacta cctcgccggt gttggtgact ctcttgatct      2220
     tgtcgtgctc ggggcctact atggtcgtgg aaaacgtact tcggtttatg gtgccttcct      2280
     tctcgctgcc tacaacccca gtaacgacac atatgagacc atatgtaaca tcggcactgg      2340
     cttctctgag gtgctacttg aagagctaca ccagacgcta gttcccttgg tgattgaccg      2400
     cccaaagcca ttctatactc attcaaccgt ccccaaggac caaccggatg tttggtttga      2460
     gccaagactg gtgtgggaag ttaaaacagc cgatttgacc ctcagcccac gctaccaagc      2520
     cgctgctgat gagttccaag gtacaaccgg cggtggaaag ggcgtgtctt tgcgtttccc      2580
     gcggtacatt aaatcccgcg acgataagaa gccagacgag gccactacca cccgtgctgt      2640
     ggcagagatg tatcggaaac aagaagcagt taccaaggac actactagca agggaggtgt      2700
     ggatgacgac tttgagtatt ga                                               2722
//

If you have problems or comments...

PBIL Back to PBIL home page