(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE358

PENCW_10.PE358       Location/Qualifiers
FT   CDS_pept        join(839678..839710,839764..843140,843230..843257)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214328" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672458"
FT                   /orf_name="Pc13g03580"
FT                   /product="Pc13g03580 protein"
FT                   /function="binding"
FT                   /protein_id="CAP91427.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00018305E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1U8"
FT                   /transl_table=1
FT                   /translation="MDNLRQESFKQLRAPCVELSSVGLRFRGNQASAADVARVLDPVHN
FT                   CLKELARNNTLDEKLAEYAFFPLSHIFNETQRLPARCLESAIHCLRILVADGWRQRLSP
FT                   AMGKQLIILLTLIVGGSPNKAEEKQLPKPKVSEELCIAGFDCLSAIFTVLKGAVPERTI
FT                   YHEIGTATVVDQTVYILLEGIVDDRLDELCLAAAKALQALYARVTDRVVLASIMPRTVS
FT                   ALAKILRPSTQTRRSYKLLETSLQILTELLRAVLNDRVASEVSPPELGSDKVALDEAWL
FT                   KATTTQIKLALANVVQVRRHQRPEVQSAIQDLCLMVIEECQTTLSESLPIMVETVVVLA
FT                   DKEDEGVNEAYRNLTHLATTYPAVLDSLKESLHTWLTSFPRIMQGNDETAKQWGLRQIS
FT                   TVFQILSQVQSGSDLLTSGLASGLCDSVGAVVKQNTNSLQPLASMDAGFNWEVLSTDAR
FT                   SKVFPPIILEHQSQQQTLKDLRSMITRLNLSESGNEITRSIVNRMHTTSGGSAIAPFWL
FT                   AMTFLRDTTTETASFDDFISLDHIEGSISLTGRGGMIEELYYISINILNELSVDGTGDW
FT                   RTSALALESVALQAQQLGEAFRPELMDALYPTLQLLASQNPNLQRHAMTCLNILTSACN
FT                   YPDTSTMIIENVDYLVNSVALKLNTFDVSPYPPQVLFMMVKLCGARLIPYLDDLVDSVF
FT                   GILDLYHGYPKLVEMMFKTLAAVVEEGARKPSLLTIDEGKGNGSHDTRKSQYQNLSISS
FT                   IAADIANRKAKRHAEDALADADGKIPHPKKPWSETYDKPPPEPSIEELLDQAESEEPPL
FT                   PPPKEPEDAEKPLTKTHALLLHIVKSIPSHLTSPSPYLRRSLLSILIDVLPALSQNETS
FT                   FLPLINELWPTVASRVIFPSSQANETSKSLIATPSTESTRKPETPDHQEEIFVTVTACE
FT                   AMEAMCKGAGDFMATRVETEFPRWDRLYRRVWEKVRADAEAANERRARSQATTVPGAVA
FT                   KPGDMASTLHLALSSSLSLSPSTPGSKFFTPHHRLWRALISLFTTVLSHVRLPLEVGDR
FT                   ICEMLCGWIALFVGPEYYFISSRTSMSVDDSASGESMVSVEDAIRAMEAWNVDLTWFAF
FT                   MRHRLGPDVVTTGATDLPFNGDGEPVRLAEYLSADDMD"
     atggacaacc tccggcagga atctttcaag cagctccgag cgccatgcgt cgaactcagc        60
     tccgtgggcc tgcgttttcg aggaaatcaa gcttccgccg ccgatgtagc ccgagttctt       120
     gacccagtac acaactgttt aaaggaactt gcgaggaaca ataccctcga cgagaagcta       180
     gctgaatatg ctttctttcc attgtcgcac atcttcaatg aaacacaaag actacccgca       240
     cgatgcttag agtcggccat tcactgtttg cggatactgg tcgccgatgg atggcgtcaa       300
     cggctgtctc ctgcgatggg caagcaactc ataatcctgt tgacgttgat cgtgggagga       360
     tctccaaaca aagcggaaga gaagcaacta ccgaagccta aggtttctga agaactgtgt       420
     attgctgggt ttgactgtct cagtgctata ttcacggtct taaaaggagc tgtcccggaa       480
     cggacaatct atcacgagat cggcaccgca actgttgtcg atcaaacagt atatattctg       540
     cttgagggaa ttgtcgatga tagattagat gagctttgtc tagcagccgc aaaggctttg       600
     caagcacttt atgctcgagt cacggaccgc gtggtgcttg ctagcatcat gccgcgaact       660
     gtgtcggcac tggctaagat tttacggcca tcgacacaga cccgcaggtc atacaagctc       720
     ctcgagactt ccttgcagat tctcacggag ctcctaagag ctgttctcaa tgaccgtgtc       780
     gcctcagaag tctccccacc ggagctggga agcgacaagg tagctctgga tgaagcctgg       840
     ttgaaggcca ccacaacgca gatcaagctt gcgctggcca atgttgtcca ggttcgccgt       900
     catcagcgac cagaggttca gtctgccatc caagacctct gcctgatggt aatcgaagag       960
     tgccagacca cactgtcaga gtctctccca attatggttg aaacagttgt cgttctagca      1020
     gataaagagg acgagggagt gaatgaagcc tacagaaacc taactcatct tgccacaaca      1080
     taccctgcag tgttggattc gttaaaggaa tcgctgcata cttggctcac ttctttccct      1140
     cgaatcatgc aaggcaacga tgaaactgct aagcagtggg ggcttcgtca gatctccacc      1200
     gttttccaga tcctgtccca agttcagtct ggatcggatt tgcttaccag cggtttggca      1260
     tccggcctat gcgatagcgt tggtgctgtt gtcaaacaga acaccaattc tctccagccg      1320
     ttggcctcaa tggatgctgg cttcaactgg gaggtgctca gcactgatgc tagatccaag      1380
     gtgttcccac ccattatttt ggaacaccaa agccagcaac aaactctcaa agatctacgg      1440
     tcaatgatta ctaggttgaa cttgtctgag tctgggaatg agatcactcg atcgattgtc      1500
     aaccgtatgc acacaacgtc aggtggttcc gctattgcac ctttctggtt ggcgatgact      1560
     ttcttgcgtg acaccactac ggaaacagcc agctttgacg atttcatctc tcttgatcat      1620
     attgaggggt ccatctcatt aactggccgt ggcggaatga ttgaggagtt gtattatatc      1680
     tcaataaata tactgaacga actgtcagtt gatgggacag gagactggcg tacatcagca      1740
     cttgctctgg aatccgtggc tctccaagct caacaacttg gcgaggcttt ccggcctgaa      1800
     ctcatggacg cgctctaccc aactttgcag ttgttggcat cacagaatcc taacctccaa      1860
     cgccacgcca tgacatgtct gaatatcttg accagtgctt gcaactaccc agacacgagt      1920
     actatgatca ttgagaacgt ggactatttg gtgaactcgg tggccttgaa acttaatacc      1980
     ttcgacgtat caccttatcc gccacaggtc ctgttcatga tggtcaaact ttgcggtgcc      2040
     cggttgatac cttatctaga tgatctggtt gattctgtat ttggtatcct ggatctatac      2100
     cacggctatc cgaaactcgt tgagatgatg ttcaaaacgc tagctgcagt cgtcgaggaa      2160
     ggagcgagaa aaccatcttt gctcacaatc gacgagggaa aagggaatgg ctcccacgat      2220
     acccgcaagt ctcaatacca gaatctctca atctcgagca tcgccgcaga cattgccaac      2280
     cgcaaagcga aacggcatgc tgaggatgca ctagcagatg ctgatggcaa aatcccccat      2340
     cccaaaaagc catggtcaga aacatacgac aaacctcctc cagagccgtc catcgaagag      2400
     ctcctggacc aagccgaatc agaggaacca ccactcccac ctcccaaaga accagaagac      2460
     gccgagaagc cgctcaccaa aacgcatgcc ctcctcctcc acatcgtcaa atcaatccca      2520
     tcccacctaa cctcaccatc tccctacctc cgacgctccc tcctctcaat cctcatcgat      2580
     gtcctacccg ccctatccca aaacgaaacc agcttcctcc ctttaatcaa cgagctctgg      2640
     cccacagtag caagccgagt aatcttccct tcatcacaag caaacgaaac atccaaatcc      2700
     ctcatcgcca ccccatccac agaatcaacc cgcaagcccg aaacccccga ccaccaagaa      2760
     gagatcttcg tcacggtaac agcctgtgag gccatggaag caatgtgcaa aggcgcaggc      2820
     gatttcatgg ccacgcgcgt cgaaaccgaa ttcccccgct gggaccggct ataccgccgc      2880
     gtgtgggaga aggtgcgcgc cgatgccgag gctgcgaacg agcgccgtgc caggtcccag      2940
     gcaacgactg tgcctggggc tgtcgctaaa ccaggagata tggcgtccac tctgcactta      3000
     gccctctctt cgtccctttc gctctcgccg tcgacgccgg gatcgaaatt cttcacgccg      3060
     caccatcgtc tgtggcgtgc gttgatctcc ctatttacca cggttctctc gcatgtccgg      3120
     ttaccgttgg aagtgggtga caggatatgt gaaatgcttt gtggctggat tgcgctgttt      3180
     gttgggcccg agtattattt catttcctca aggacttcta tgtctgtgga tgattctgca      3240
     tctggtgaaa gtatggtttc tgttgaggat gccattcggg caatggaggc ttggaatgtg      3300
     gacttgacgt ggtttgcctt tatgcggcat cgcttgggac cggatgtggt tactacaggc      3360
     gctactgatc tccctttcaa tggcgatggg gagccggtta gactagctga gtaccttagt      3420
     gctgatgata tggattga                                                    3438
//

If you have problems or comments...

PBIL Back to PBIL home page