(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE360

PENCW_10.PE360       Location/Qualifiers
FT   CDS_pept        join(845721..845820,845875..846024,846101..846236,
FT                   846294..846701,846753..847129,847183..847283,8
FT                   47339..847593)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950876"
FT                   /orf_name="Pc13g03600"
FT                   /product="Pc13g03600 protein"
FT                   /function="ATP binding"
FT                   /function="hydroxyethylthiazole kinase activity "
FT                   /function="magnesium ion binding"
FT                   /function="thiamine-phosphate diphosphorylase activity "
FT                   /biological_process="thiamine biosynthetic process "
FT                   /protein_id="CAP91429.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004417"
FT                   /db_xref="GO:0004789"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009228"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="UniParc:UPI00018305E3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X4"
FT                   /transl_table=1
FT                   /translation="MTVDLSLYLVTDSTPAILKGRDLCTVVESALQGGVTVVQYRDKTN
FT                   DTGVQVETARKLHRVTKKYNVPLLINDRVDVALAIGAEGFTEAKKLLPENAIIGISTSS
FT                   VEEAKKATADGADYIGIGTMFATPTKTNTKSVIGTAGTQVILDAIKDSPIGTVSIGGIN
FT                   HSNVQRVLYQSQSPKKALDGVAIVSAIVGADDPKASAEHFVELIRNPPRFAQIANPPRA
FT                   NEAEALLNEVPQIIRKMVEVHPLVHNMINFVVSNFVANVALSIGASPIMSPYGDEATDL
FT                   CKFDGALLINMGTLTSESVSNYVKAIKAYNDRGNPVVYDPVGAAATHIRRNAVAQLMAG
FT                   GYFDLIKGNEGEIRQVWGSSAVQQRGVDSGPSTLDGNQKATLARDLARRERNVVLLTGA
FT                   TDYLSDGERVIAVENGHPYLGQVTGTGCAIGTISGCFLAAHRSDRLLAVLSGILMYEIA
FT                   AENAAAKEYVRGPGSFVPAFVDELYAIRTAAANGDDSWFAGRAKVHEVKL"
     atgaccgtag atctgtcgct ctatttggtc acggattcga ccccggccat tctcaagggg        60
     cgagatttat gtacagtggt agaaagtgct ctacaaggag gcgtgacggt ggtgcaatac       120
     cgggacaaga ccaacgatac tggcgtccag gtggaaactg cccggaaact acaccgggta       180
     accaagaaat acaatgtgcc tcttctgatc aatgaccggg ttgatgtggc tcttgccatt       240
     ggtgcggagg gcttcaccga ggcaaagaag cttcttccgg agaatgctat cataggtatc       300
     agcacatcct cagtcgagga ggcaaaaaaa gccaccgccg atggcgccga ctatatcgga       360
     attggtacca tgtttgccac cccgactaaa accaatacca agtcagtcat cgggacggca       420
     ggtacgcaag tcatcctgga tgccattaaa gattccccca taggcacagt ttccatcggt       480
     ggcatcaatc actccaatgt tcaacgagtg ctctatcagt ctcagtcacc gaagaaagca       540
     ctggatggag tggccatagt tagtgctatc gtgggagccg acgaccctaa agcatctgcc       600
     gagcacttcg tcgagctcat ccgcaaccct ccccggtttg cgcagatcgc caaccctcca       660
     cgtgctaacg aggccgaggc cttgttgaat gaggtgcccc agatcatccg taagatggta       720
     gaggtgcatc ctcttgtaca caacatgatc aatttcgttg tttcgaactt tgtggccaac       780
     gttgcccttt ctattggcgc atctcccatc atgtctccgt acggcgatga agccacggac       840
     ttgtgcaagt ttgatggcgc tcttctgatc aacatgggta cattgactag tgagagtgtc       900
     tcaaactacg tgaaagccat taaggcatac aatgatcggg gcaacccagt ggtctacgac       960
     ccagtcggtg cggctgcgac acacattcgc cgcaacgcag tggctcaact tatggccggg      1020
     ggttactttg atctgatcaa gggtaacgag ggagagattc gccaagtttg gggtagcagt      1080
     gctgttcaac agcgcggtgt cgacagcgga ccgagtaccc ttgacggcaa tcaaaaagcc      1140
     acgttggctc gggacctggc tcgcagagag cgaaacgttg tgctattgac cggagcaaca      1200
     gactacctca gcgatggcga gcgggtcatt gcggtcgaga atggccaccc atacctgggc      1260
     caagtgaccg gaactggctg tgccattggc acaatctccg gttgcttctt ggctgcccac      1320
     cgttccgaca ggctcctcgc agttttgtcc ggaatcctca tgtatgagat tgcggcggag      1380
     aacgccgcgg ccaaagagta tgttcgcggc ccgggcagct tcgtcccggc attcgtcgat      1440
     gaactttacg ccatccgtac agcggcggca aacggtgacg atagctggtt cgccggccgg      1500
     gccaaggtgc acgaggtgaa gctatag                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page