(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE362

PENCW_10.PE362       Location/Qualifiers
FT   CDS_pept        complement(848773..849897)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950878"
FT                   /orf_name="Pc13g03620"
FT                   /product="Putative uncharacterized protein Pc13g03620 "
FT                   /protein_id="CAP91431.1"
FT                   /db_xref="UniParc:UPI00018305E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y0"
FT                   /transl_table=1
FT                   /translation="MARLLDLPAELILAIIDYLQVDTKEASLLFDRLGYDQVYSPEPPL
FT                   SVSRLHSFLLANCRLNSLLQPLLYRDIFVRRNVQLKQLSRSLQNNPSLKEHIISATLPW
FT                   HSSMHGTLNGISHFFWFNNLRTLTIYGFCDWDSLKFDDSLIGTSSVECLRLIACGAHEQ
FT                   PLTTLLSWPVALKTLYYGIDKREWRLNYLFQLKRTLWTRAAFMRALQRQKATLVELTLA
FT                   RSWDDEDYLRNGPHLDLSEFTSLKTLRICHTFLGVNSHTPYEAWEGLPHSLEVLEVSYD
FT                   DTDRALFVWANYKYDRFVLHLINHKRTYRTHLHTVIIHSTEKVHDLETGEKRPIGLLTW
FT                   PSLTREAESAGIELKMGLGYEDAPTTRKVTFPSP"
     atggcacgtc tgctggacct tccagctgag ctgattctag ccatcattga ctacctacaa        60
     gtggacacga aggaggcatc actgctattc gatagacttg gatatgacca ggtctattcg       120
     cccgagcctc cactgagcgt cagccgcctt cattctttcc tgctcgccaa ctgtcgcctg       180
     aacagccttc tacagccact gttatatcgc gatatcttcg ttcgcagaaa tgttcagctg       240
     aagcagctct cccggagtct tcagaataac ccgagtctca aggaacacat catctcggcg       300
     accctcccat ggcactcctc tatgcatggc actctcaatg gtatctctca tttcttctgg       360
     ttcaacaacc tacgaaccct tactatttac ggcttctgtg attgggattc attgaagttt       420
     gacgattcac ttattggcac ttcgtctgtt gaatgtctaa gactgattgc ttgtggggcg       480
     cacgagcagc ctttaaccac tctgttaagc tggccggtgg cgttgaaaac gctttactac       540
     ggtatcgaca aacgcgagtg gagactcaat tatctgttcc aattaaagcg cacactctgg       600
     acgcgtgctg cttttatgcg cgcgttgcaa cggcaaaaag caacgctggt tgaactgaca       660
     ctggcaaggt catgggatga tgaagactac ctgcgcaatg gacctcatct tgacctgagc       720
     gagttcacat ccctcaaaac tctgcgtatt tgtcacacct ttctcggtgt aaatagccac       780
     actccatacg aggcctggga gggcttaccc cacagtctgg aggtgttgga ggtctcctat       840
     gacgacacag accgcgctct attcgtatgg gctaactata agtacgaccg ttttgttctt       900
     cacttgatca accacaagag aacgtatcgc acgcatctac acacagtgat tatccactcg       960
     acggaaaagg tccacgatct cgaaacaggg gagaaacggc ccattggtct cttgacatgg      1020
     ccgtcgctca cgcgtgaagc tgaatccgct ggtatagagc tgaagatggg gttgggatac      1080
     gaagatgctc caaccacgag aaaagtgacg tttccaagtc cctga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page