(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE363

PENCW_10.PE363       Location/Qualifiers
FT   CDS_pept        join(complement(852216..852414),complement(850750..852158))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214295" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672459"
FT                   /orf_name="Pc13g03630"
FT                   /product="Pc13g03630 protein"
FT                   /protein_id="CAP91432.1"
FT                   /db_xref="UniParc:UPI00018305E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X2"
FT                   /transl_table=1
FT                   /translation="MDAQYPFASRDDIWRVFDELKELHIAQYEQGERLAQLERRRDDDA
FT                   RLRSPWCPVSPFPQSAGAIAPDPTFPSPPDAFKGFDQGHHSAMASSAVGFDAEDEPRRG
FT                   ASRANSVRFDESAIHGNGQASRSSNDLPLRTGSGLSTHPLLERTFSHQSDGRLSSSGHS
FT                   HHSARTNSLRLNTTRLLGTTPIESPLIPPPGLFLLGPVPSIIRCWLTDTFTNGSLLYAA
FT                   VCSGSYVSTLGLSMVREFGMENMIVRESDVQYIKLPLYLPEALIHPSSSRPGTPTHQVP
FT                   TVTIRFVVREIDVGDGSIQIIIGSDVMRAHNADILFSQDKLIMVDDDHNRVSVPLVRPE
FT                   KDSVFKSLCTYPGTSDSGVILGPPTNGNPSVGIIGRPANVPQKPASAPPSARLPGSENI
FT                   DPHKSHLQNSQAHAHISAETRPASAHPPTPEPTKTEDMSCWSSWRRDPKRSTTTQKPAD
FT                   KREMKVFRTGKSASHANSTTSVSAPGSATAEQADKSSVPFTSVHHPTTPSDRHGTLNPV
FT                   GGASAFGWLNSPHHNASS"
     atggatgcgc agtatccctt tgcttcccgc gacgacattt ggcgtgtctt tgacgagttg        60
     aaggagctcc acattgccca gtacgagcaa ggagaacgac tcgcacaact ggagcgtcgc       120
     cgggacgacg atgctcgact gaggagtcct tggtgtcctg tgtcaccgtt tccgcaatcg       180
     gctggagcga tcgctccaga ccccaccttc ccctcccccc cggatgcttt taaaggattc       240
     gatcaaggcc accattccgc aatggctagt tctgctgtgg gatttgacgc cgaggacgag       300
     cctagacggg gtgcatcgcg ggccaacagt gtccgttttg acgaaagtgc tatccacggg       360
     aacggccagg ctagccgttc cagcaacgac cttcctttgc ggaccggcag cggcttgagt       420
     acccacccac ttcttgaacg gacattttct caccagtctg atggaagatt gagttcatcc       480
     ggccactcac accattccgc tcgaactaat agcctgcgcc tgaacaccac tcggctgctt       540
     ggtactacgc ctatcgaatc ccctttgatt ccccctcctg gactcttctt gctgggaccg       600
     gtcccgtcca ttattcggtg ctggttgaca gatactttca ctaatggctc tctcctctac       660
     gcagccgttt gctcgggctc ttacgtctca actttgggtc tttccatggt ccgtgaattt       720
     gggatggaga acatgattgt gcgcgagagc gatgtccagt acatcaaact gccgctgtat       780
     ctccccgaag cacttattca cccatcttcg tcgcgccccg gaacccctac tcaccaagtt       840
     ccaaccgtga ccattcgctt tgtggttcgc gagatagatg tcggcgacgg ctcaattcag       900
     atcatcattg gaagcgatgt gatgcgtgca cacaatgctg atattttatt ctcgcaagat       960
     aaattgatca tggtggacga cgaccacaac cgcgtgtctg ttcccctcgt gcgtcccgag      1020
     aaggactccg tgtttaagtc tctttgcact tatcccggta cttcagattc cggagtcata      1080
     ctggggcctc ctactaacgg aaatccatcc gtcggtatca ttggccggcc tgccaatgtt      1140
     ccccagaaac cggcctctgc gcccccatcg gctcgtctgc ctggcagcga gaatattgat      1200
     cctcacaagt cccacctaca gaactcccag gctcatgctc acatttcagc tgaaactcgt      1260
     ccggcctctg cccatccacc gactcctgag cctactaaaa ccgaggatat gtcttgttgg      1320
     agctcatggc gtcgcgatcc caagagatcc accaccaccc agaagccggc cgataaacgc      1380
     gagatgaagg tcttccgcac cggaaaatct gccagccatg cgaactccac aacttcggtc      1440
     tcggctcctg gcagtgctac cgctgagcag gccgacaagt cgtctgtacc atttacttct      1500
     gtccaccatc cgactactcc ttcggacaga catggtacac tgaatcccgt gggtggtgca      1560
     tcggcgtttg gatggctcaa ctcgccccat cacaatgcct cgtcctag                   1608
//

If you have problems or comments...

PBIL Back to PBIL home page