(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE364

PENCW_10.PE364       Location/Qualifiers
FT   CDS_pept        join(854373..854487,854564..854703,854820..855062)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214251" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978323"
FT                   /orf_name="Pc13g03640"
FT                   /product="Pc13g03640 protein"
FT                   /protein_id="CAP91433.1"
FT                   /db_xref="UniParc:UPI00018305E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X5"
FT                   /transl_table=1
FT                   /translation="MDPTTPSDWPPSDLSSSSEDNKKNAPTMDSRPTAKELLDRVDYDI
FT                   SQLLQRFENIIAIAAKKFDGTSHVDAAVEAFQIDVESTALIRAAEDLLALHRLMKELWL
FT                   FGKLDTLGEDERDIQRREKLEEDVKAIQKALDGGLLMPSSEEPDKPEKSEDTEKHRAVP
FT                   EA"
     atggatccga cgactccttc ggattggcct ccttcggatt tatcctcatc atccgaagac        60
     aataaaaaga acgctccgac catggattcg cgtccaactg ccaaggagct gcttgatcgc       120
     gtcgactacg acatctcgca gctgctgcag cggttcgaga acatcatcgc tattgctgcc       180
     aagaagttcg acggcaccag tcacgttgat gctgctgttg aagcattcca aattgatgtc       240
     gaatctactg cgctgatccg tgctgcggag gacctactcg ccttgcaccg tctcatgaag       300
     gagctttggc tcttcggcaa actcgatacc ctcggcgaag acgagcgaga tatccagcgt       360
     cgtgagaagc tcgaggagga tgtgaaggct atccagaagg cccttgatgg aggattgttg       420
     atgccttcgt cggaggagcc tgataagccg gagaagtcag aagacactga aaagcaccgt       480
     gcagtcccag aagcctga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page