(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE365

PENCW_10.PE365       Location/Qualifiers
FT   CDS_pept        855551..856378
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214262" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672460"
FT                   /orf_name="Pc13g03650"
FT                   /product="Pc13g03650 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="dihydrofolate reductase activity"
FT                   /biological_process="glycine biosynthetic process "
FT                   /biological_process="nucleotide biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91434.1"
FT                   /db_xref="GO:0004146"
FT                   /db_xref="GO:0006545"
FT                   /db_xref="GO:0009165"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="UniParc:UPI00018305E8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X6"
FT                   /transl_table=1
FT                   /translation="MPPHNPHHLPSLTLIVATTPIRTASTTTKEEITRLGIGLNGTLPW
FT                   PRIKTDMSFFARVTSRPPTPGTTNAIIMGRKTYDSVPGSLRPLAKRINVVITRDTSGSV
FT                   RESVTTELGNMRRKIAAKAAQTQATNSEKGTFDPPKEAAPADPMTDAIVTPSLGAALET
FT                   LDSVYAAQGKLGKIFVIGGAEIYNATLNMGAEELRGRPVRVVMTNVVRKGAVGASASFE
FT                   CDTFFPLDGLHEKNGWRAVSPREVSEWVGEEVDGEWKTDGDVEVQMVGYEKST"
     atgccacctc acaaccccca ccacctcccc tccctcacgc taatcgtggc aacgaccccg        60
     atccgcaccg cgtcaacaac cacaaaagaa gaaatcacgc gcctaggcat aggcctaaac       120
     ggcacgctcc catggccgcg cataaaaaca gacatgtcat tcttcgcacg cgtgacatct       180
     cgcccaccaa ccccaggcac gacgaacgcg atcatcatgg gccgaaagac gtacgactca       240
     gtaccgggct cgttgcgccc gctcgcgaag cgaattaacg tcgtgatcac gcgtgacacg       300
     tccgggtctg ttcgcgagag cgtaactacg gaattgggga atatgaggag aaagattgcg       360
     gccaaggccg ctcagacaca ggctacaaat tcggaaaagg ggacttttga cccgcccaag       420
     gaagctgctc cggcggaccc gatgacggat gcgattgtta cgccgagttt gggcgcggca       480
     ttggagacgt tggactctgt gtatgcggcg caggggaagc tgggcaagat ttttgtaatt       540
     ggtggggcgg agatttataa tgctacgttg aatatggggg ctgaggagct gcgtggtcgg       600
     cccgttaggg ttgttatgac gaatgtcgtg cggaaggggg ctgtgggtgc gtctgcttcg       660
     tttgagtgtg atacgttctt cccgttggat gggcttcatg agaagaatgg gtggcgggct       720
     gttagccctc gggaggtttc tgagtgggtt ggggaggagg ttgatggcga gtggaagacg       780
     gatggggatg tcgaggttca gatggttgga tatgaaaagt cgacttag                    828
//

If you have problems or comments...

PBIL Back to PBIL home page