(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE366

PENCW_10.PE366       Location/Qualifiers
FT   CDS_pept        join(complement(858657..859495),complement(857306..858506),
FT                   complement(856866..857252),complement(856651..856809))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164493" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129522"
FT                   /orf_name="Pc13g03660"
FT                   /product="Pc13g03660 protein"
FT                   /function="voltage-gated chloride channel activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAP91435.1"
FT                   /db_xref="GO:0005247"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniParc:UPI00018306B4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X7"
FT                   /transl_table=1
FT                   /translation="MPRSLPKTSFASREQEDTENTRSAQTAPPSPSAYRRSQSYLSETH
FT                   TEYQSLDPPLEITEATSLLGPQAARRRGPRRSYTSTSGVSGTGPDSLRHVLAAGSLRRT
FT                   RNHSRANSMGRRVSRRGSIDGDGEPASLPPSTKDNLTASAFLDERTWYDQFTSTDWVHD
FT                   SIADGARLRLLRQRKDVRGRLLAAFDGAQGWILVALIGCITASIAYFVDVTEGSVFDLK
FT                   EGFCTTQFFRNKRTCCEGLATCDAWRPWSRIFSPSGTERQWVDFVIFVIWVVTLALISP
FT                   PHGTLPNYPPRPAMIYYSAAGSGVAEVKVINSGFVLHGYMGLKTLVIKTIGLIFSVSSG
FT                   LSLGKEGPYVHIATCVGNISCRLFDKYNQNDGKRREVLSASAASGVAVAFGAPIGGVLF
FT                   SLEEVSYYFPPKTLFRTFFCCIAATLSLKFLNPYGTGKIVLFEVRYLSDWQIFEIFIFI
FT                   LLGIMGGAAGALFIKASSLWARSFRRIPAIKRWPMFEVFLVALFTGLVSFWNRYTSLPV
FT                   TELLFELASPCESDVESTGLCPRTDGILEIVQDLLVAFVIKSFLTIITFGIKVPAGIYV
FT                   PSMVVGGLMGRIVGHLIQYWALRHPTFFLFDSCPAVAGIESCVTPGVYALIAAGATMCG
FT                   VTRLSVTLPVILFELTGSLNHVLPFSLSVLCAKWTADAIEPRSIYDLLTDMNSYPFLDS
FT                   KLQPTTDAVLGDIVRPVRKNRIIDISASPFLPATELRLKLEHLLMAGELDSGLPILCDG
FT                   VLAGLIPAPDLEYALDTLGDEEENTICLMTMDASTVLYDSDNEDAEQVDFSRYIDPAPI
FT                   ALDVHSPIDLVYQCFAKLGLRYLCVTQNGKYAGLVHKKAFVKFMKENSD"
     atgcctcgat cccttccaaa gaccagtttt gcctcgcgcg aacaggagga cactgaaaac        60
     acgcgcagtg cccaaacagc tcccccctca ccgagtgcct acagacggtc ccaaagctac       120
     ctctccgaaa cacatactga gtaccagtcc ctcgatccgc ccttggagat tacagaagca       180
     acgagcctcc tcgggcccca agccgcccgt cgacgaggtc cgcgacggtc ttacaccagc       240
     acttccggag tgtcaggcac cggcccggac tcattgagac acgttctggc agctggcagt       300
     ctgcgacgaa cgcggaatca tagccgtgcc aactccatgg gcaggcgggt cagtcgccga       360
     gggagtatag atggcgatgg cgaacccgcc agccttcctc cgtccacgaa ggacaatctt       420
     actgcctctg cgtttctgga tgagcggact tggtacgatc agtttacttc gacagattgg       480
     gtgcatgaca gtatcgccga tggagcacga ctccgcctac ttcggcagcg gaaagacgtg       540
     cgaggccgat tgctggcggc cttcgatggc gcgcagggat ggatcttggt cgcgctcatt       600
     gggtgcatca cggcgtccat tgcttacttc gtcgatgtca ctgaaggatc ggtctttgat       660
     ttgaaggaag gcttctgcac gacccagttt ttccgtaata aaaggacttg ctgtgaaggg       720
     ctggctactt gtgatgcatg gcggccctgg tccaggatct tctcgccatc gggtacagag       780
     aggcagtggg ttgactttgt catttttgtc atttgggttg tgacgttggc cctcatatct       840
     ccaccgcatg gaactttgcc taattatccg ccccgtccag ctatgatcta ctactctgct       900
     gctggcagtg gagtggcaga agtcaaagtc attaatagtg gttttgtcct tcacggatat       960
     atgggactga agacgctagt cattaaaact atcggtttga tcttcagtgt ttcgtctggt      1020
     ttgagcttgg gtaaagaagg cccctacgtt catattgcca cctgcgtggg caatatctcc      1080
     tgtcgtctgt tcgacaagta taatcagaac gatggaaaga gacgagaggt tttgagtgcc      1140
     agtgccgcca gcggtgtggc tgtggccttt ggcgctccga ttggtggtgt tctctttagc      1200
     ttggaagaag tcagctacta tttcccaccc aagacccttt tccggacgtt cttttgttgc      1260
     attgcggcta ccttgtctct caagttccta aacccctatg gaacaggtaa gattgtccta      1320
     tttgaggtcc ggtacctttc cgactggcaa atcttcgaga ttttcatttt catccttctc      1380
     ggtattatgg gaggcgccgc tggtgcgctc tttatcaaag cctcaagcct atgggcgcga      1440
     tcattccgtc gcatcccagc catcaagcgt tggcccatgt ttgaagtttt cctcgttgcc      1500
     ctatttaccg gccttgtcag cttctggaat cgatacacga gccttcccgt caccgaactt      1560
     ctatttgagc tggcttcgcc ttgtgaatca gatgtggaaa gtacgggact gtgtcctcgc      1620
     accgacggca ttcttgaaat tgtgcaggac cttctggtgg cgtttgttat caagagtttc      1680
     ctgaccatta ttaccttcgg catcaaagtg cctgcgggca tctatgtgcc atccatggtt      1740
     gttggtggct tgatggggcg aattgttgga catttgatcc agtactgggc tctcaggcat      1800
     cccacctttt tcttattcga ctcttgtcct gcggttgctg gaattgagtc gtgcgtgact      1860
     ccaggggtct atgcattgat tgccgctgga gcgaccatgt gcggcgtgac acgactatca      1920
     gtcactttgc ctgtgatcct gttcgaactg acaggaagtc tcaaccacgt gcttccgttt      1980
     tctctgtccg tactctgcgc aaagtggact gcggatgcca ttgagcctcg cagtatctac      2040
     gacctcctga ccgatatgaa ctcctacccc ttccttgata gcaaactcca accgactacg      2100
     gatgccgtgc taggagacat agtccgaccg gtgcggaaga atcgcatcat cgatatctca      2160
     gcgtcgccat tcttaccagc cacggaactt cgattgaaac tggaacacct gctcatggca      2220
     ggcgagctgg acagcgggct tcccattcta tgtgacggcg tccttgctgg tctgatccca      2280
     gcaccggatc tcgagtacgc attggatacg ctaggcgatg aagaagaaaa tacgatatgt      2340
     ctaatgacta tggatgcttc cacggtcctc tatgacagcg ataacgagga cgcggaacaa      2400
     gtggatttca gtcgatacat tgaccctgct ccaatcgctc ttgatgtcca ttcccctatc      2460
     gatttggtct accagtgctt cgccaagctg ggtcttcgtt acctctgcgt cactcagaac      2520
     gggaaatatg ccggcctggt acacaagaaa gcgttcgtga aattcatgaa ggagaatagc      2580
     gactag                                                                 2586
//

If you have problems or comments...

PBIL Back to PBIL home page