(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE367

PENCW_10.PE367       Location/Qualifiers
FT   CDS_pept        join(862510..862642,862707..862746,862796..862874,
FT                   862950..863340,863394..863527)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214294" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825158"
FT                   /orf_name="Pc13g03670"
FT                   /product="Pc13g03670 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP91436.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI00018306B5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1X8"
FT                   /transl_table=1
FT                   /translation="MAAIEKGNEDAFKPYDQFLLFGDSITQMGCNQELGFAFHAALQES
FT                   YSRKLDVINRGLAGYTTAHAVKVFDKFFPSPQTANVRFMTIFFGANDACVPTHDQHVPL
FT                   DQYKKNLKTIIQHPATRAQNPRLMLITPPPVNEYQIEEFDASKNTPFPSRTASFTKSYA
FT                   LAACEVGASLNVPVVDLWSAFMKITGWKEGDPLIGARDVPRNDKLASLLTDGLHLTPAG
FT                   NRIVYDEIMKVVQANWPDQTPETLPMVFPAWGDAPK"
     atggctgcca tcgagaaggg gaatgaggat gcattcaaac cgtatgacca gttccttctc        60
     ttcggagact ccatcactca gatgggctgc aaccaagagt taggtttcgc atttcatgct       120
     gcactccaag aatcctacag tcgcaaattg gatgttatta atcgcggcct ggctggatat       180
     acaaccgccc atgctgtcaa agtctttgat aagttcttcc cttcgccaca gacggctaat       240
     gtgcggttca tgaccatctt cttcggtgct aatgatgcat gcgttccgac ccacgaccag       300
     catgtgcccc tggatcaata taaaaagaac ctgaagacga tcattcagca cccagcaaca       360
     cgcgcacaga acccacgcct catgctgatc accccacctc ccgtgaacga gtatcaaata       420
     gaggagtttg acgcttcaaa gaacaccccg ttcccaagtc gaactgctag cttcaccaag       480
     tcatacgcac tggctgcgtg cgaagttggt gcatcgctca atgtcccggt ggtggactta       540
     tggtccgcct tcatgaagat cactggctgg aaggagggag atcctctaat tggggctcgt       600
     gatgtgccga ggaatgacaa attggctagt cttcttactg atggtctcca tctgactccc       660
     gctggtaacc gcatcgtcta cgatgaaatt atgaaggtag tccaggccaa ttggccggat       720
     cagacgccgg agactcttcc aatggtgttc cccgcgtggg gtgacgcacc gaaataa          777
//

If you have problems or comments...

PBIL Back to PBIL home page