(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE368

PENCW_10.PE368       Location/Qualifiers
FT   CDS_pept        join(complement(864926..864935),complement(864845..864867),
FT                   complement(864714..864790),complement(864365..864661),
FT                   complement(864234..864312),complement(864010..864180),
FT                   complement(863919..863954),complement(863785..863820))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214250" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672461"
FT                   /orf_name="Pc13g03680"
FT                   /product="Pc13g03680 protein"
FT                   /biological_process="nuclear mRNA splicing, via spliceosome"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAP91437.1"
FT                   /db_xref="GO:0000398"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="InterPro:IPR006973"
FT                   /db_xref="UniParc:UPI00018306B6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1Y1"
FT                   /transl_table=1
FT                   /translation="MTTAHRPTFDPAQGKEALRGPAYHQRLLPAHTHLKVRQPGQGGEA
FT                   DAHLSPRDLRAELLQAEAAHFAKKNGVPVEQPAIAESSVPKRQLEAAPEDGIDGDIKEE
FT                   DPEAKRRRILEETRDIDADSDGSEEDSSDEDSDDDEAAELMRELEKIKKERLEQKEKEE
FT                   RERALEEEEQREVDIARGNPLLNSQDFNMKRRWDDDVVFKNQARGTENRDGKEFVNDLL
FT                   RSDFHKRFMISVLEGFQLSE"
     atgactacag cccacagacc tacttttgac ccggcgcaag gcaaagaagc cctccgtggc        60
     ccggcctacc atcagcgact cctccccgcg cacacacacc tgaaagtccg ccaacccgga       120
     caaggcggcg aagccgacgc ccacctatcg ccccgtgacc ttcgcgcaga gcttctccaa       180
     gccgaggcag cacactttgc caaaaagaac ggcgttccgg tcgagcagcc agctattgct       240
     gaatcctcag ttcccaagcg acaactcgaa gctgcgcctg aagatggaat cgatggcgac       300
     atcaaggaag aggacccaga ggcgaaacgc cgacgtatac tggaggagac acgcgacata       360
     gatgccgatt cagatgggtc agaagaagac agcagtgacg aggacagcga tgacgacgaa       420
     gcagccgagt taatgcgaga gcttgagaag atcaaaaagg agcgattgga gcaaaaggag       480
     aaagaggagc gtgaacgcgc actcgaggaa gaagagcaaa gagaggttga tatcgcgcgc       540
     ggtaatcctc tgctcaattc ccaggatttc aacatgaaac ggcgctggga tgacgatgtt       600
     gtattcaaga accaggctcg gggaacagag aacagagacg gcaaggaatt tgtcaacgat       660
     cttcttcgtt ctgatttcca caagcgcttc atgatatcag ttctagaggg atttcagctt       720
     agcgaatga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page