(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE369

PENCW_10.PE369       Location/Qualifiers
FT   CDS_pept        join(865194..865357,865417..865536,865596..866205)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000229504" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950879"
FT                   /orf_name="Pc13g03690"
FT                   /product="Pc13g03690 protein"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAP91438.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00018306B7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H218"
FT                   /transl_table=1
FT                   /translation="MSKEAQLSIAERDFILEALRENVRLDGRQPDDYRPLNISFGEEYG
FT                   HVNLQLGKTNIIVRISAEVTKPREDRPFDGLFNINLELTAMGSPAWESGRTNDIEAYAT
FT                   NTLDRIIRHSNALDTESLCILKGVSCWSIRADVHVIDYDGNITDAACIAIMAGLQHFRR
FT                   PDAVVRDGRVIVYGVEQRVPVALNITHKPLSVTFHTFNDSKHVIVDATLKEEQAAEGDL
FT                   VIGINSAGDVCYLSKYAGAPADAMVIVKKTNVAWEKVKEINAAVEKVLQADLAKRAKIG
FT                   MADESRAENDRLVQIE"
     atgtcgaaag aagcgcaact ctcaatcgca gagcgcgact ttatccttga ggcgctccgt        60
     gagaatgtgc gtctcgacgg tcgccagcct gacgactatc gtcctttgaa tatctccttt       120
     ggtgaagaat atggacatgt gaacctgcag cttgggaaga cgaacattat tgttcgcatc       180
     tccgctgagg ttactaaacc gcgtgaagac cgaccctttg atggtctctt caacatcaac       240
     ctggagctga ctgcaatggg ttcaccagct tgggaaagcg gacgaaccaa cgacatcgag       300
     gcctacgcca ccaacaccct tgaccgtatc atccgccatt ctaacgccct cgataccgaa       360
     tccttgtgta ttctgaaggg tgtgagctgc tggtcgattc gggctgatgt tcacgttatc       420
     gactacgatg gaaacatcac cgatgcggcc tgtattgcga tcatggctgg actgcaacat       480
     ttccgccggc cggatgctgt ggtgagagac ggacgtgtca tagtctacgg cgtggagcag       540
     cgtgtgcccg tcgcacttaa catcacacac aagcccctct cggtcacttt ccacaccttc       600
     aatgacagca agcatgtcat tgttgatgct accctcaagg aggagcaggc tgctgagggt       660
     gatcttgtca ttggcattaa tagcgccggc gatgtctgct acctctcaaa gtatgcaggt       720
     gcacccgcag atgccatggt aattgtgaag aagacgaacg tggcatggga aaaagtcaag       780
     gagatcaatg ctgctgttga gaaggtcctc caggccgacc tggctaagcg ggcaaagatt       840
     ggcatggccg acgagtctcg ggcagagaat gaccggttgg ttcaaatcga ataa             894
//

If you have problems or comments...

PBIL Back to PBIL home page