(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE37

PENCW_10.PE37        Location/Qualifiers
FT   CDS_pept        88107..>88580
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200294" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824591"
FT                   /orf_name="Pc13g00370"
FT                   /product="Pc13g00370 protein"
FT                   /protein_id="CAP91106.1"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI0001830DC9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H182"
FT                   /transl_table=1
FT                   /translation="MDGIDVANKASSEANSVMNSASTAVIYASGAAETAASQVTDKIQS
FT                   LSDEINSHLPGFYSVGLWGYCQGQKETSSYSNCSQPSTSFSFDLLSILGSASPVIDGIL
FT                   PDGNNKVLAGYHGVSRWSISAYILGFVSTFVAVVFGVTTMFFSWGKILLIISSL"
     atggacggaa tcgatgttgc aaacaaagcc agtagtgagg ccaacagcgt tatgaatagc        60
     gcttctactg ctgtaattta tgcctcgggc gccgcagaga ctgcagcgag ccaggtgacc       120
     gataagattc aatctttatc agacgaaatc aactcacacc tgccgggttt ctattctgtg       180
     gggctttggg gatattgcca aggccagaag gaaacatcat cttattccaa ttgctcgcaa       240
     cccagtacct ccttctcgtt cgacttgttg agcattttgg gctcggcttc cccagtcatc       300
     gacgggatac taccagatgg gaataacaag gtgcttgctg gatatcacgg tgtttctcgg       360
     tggtcaatct cagcttacat cttgggtttt gtttcaacat ttgtggctgt tgtcttcgga       420
     gtcaccacaa tgtttttttc gtggggaaaa atattgctca tcatttcttc cttg             474
//

If you have problems or comments...

PBIL Back to PBIL home page