(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE370

PENCW_10.PE370       Location/Qualifiers
FT   CDS_pept        join(866999..869928,869983..870286,870337..871185)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202528" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129523"
FT                   /orf_name="Pc13g03700"
FT                   /product="Pc13g03700 protein"
FT                   /EC_number="3.6.3.8"
FT                   /function="ATP binding"
FT                   /function="calcium-transporting ATPase activity "
FT                   /function="magnesium ion binding"
FT                   /function="phospholipid-translocating ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91439.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004012"
FT                   /db_xref="GO:0005388"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00018306B8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H219"
FT                   /transl_table=1
FT                   /translation="MASGRPPGSHPAAGRDDDLLLDSGPMYSTGQGPPVNDEHLLERYN
FT                   IDDSEQPYAQTQPRPSVSYDNFVGSSVQQGATRHNVASGPAHPPVNPGLHSNDPYSSGT
FT                   RDRTYSQTSGLDNYRRYSLDDFDDGHSGYYDLDADEDRIASSHHVRKANERNSVLGLGG
FT                   GFMGKAKYMFGMGSSQYSEMDLPLTESGARRATVGSDASPAPPPKQRKKFRASDLNIFS
FT                   RKVDPSTLGPRMIQLNNPPANATHKFVSNFVSTAKYNIFTFIPKFLFEQFSKYANLFFL
FT                   FTAVLQQIPNVSPTNRYTTIVPLAIVLAVSAIKELVEDYKRRMSDRGLNYSKTQVLKGS
FT                   SFHEAKWVDVVVGDIVRVESEQPFPADLVLLASSEPEGLCYIETANLDGETNLKVKQAI
FT                   PETAHLVSPSDLSRLSGRVRSEQPNSSLYTYEATLTMNAGGGEKELPLAPDQLLLRGAT
FT                   LRNTPWIHGIVVFSGHETKLMRNATATPIKRTAVERTVNIQILMLVSILIVLSVISSVG
FT                   DLAIRKTRSSTLAYLGYGGSVKLVKQFFMDIFTYWVLYSNLVPISLFVTIEIVKYFQAF
FT                   LINSDLDIYYDKTDTPAICRTSSLVEELGQIEYIFSDKTGTLTCNMMEFKQVSIAGVQY
FT                   GDDVPEDRRATVEDGAEIGIHDFKTLKKNLQSHPSQNAIREFLTLLATCHTVIPERNSE
FT                   DPNVIKYQAASPDEGALVDGAASLGFRFTNRRPRSVIFEVGGQELEYELLAVCEFNSTR
FT                   KRMSTIFRCPDGKVRVYCKGADTVILERLHPDNPTVEATLQHLEEYASDGLRTLCLAMR
FT                   EVPENEFQQWHQIYDKASTTVDGNRADELDKAAELIEKDFYLLGATAIEDRLQDGVPDT
FT                   IHTLQTAGIKIWVLTGDRQETAINIGMSCKLISEDMTLLIINEETSEATRDSLQKKMDA
FT                   VQSQISAGDSEPLALVIDGRSLTFALEKDMEKLFLDLAVICKAVVCCRVSPLQKALVVK
FT                   LVKRHKKALLLAIGDGANDVSMIQAAHVGVGISGVEGLQAARSADVAIGQFRFLRKLLL
FT                   VHGAWSYSRISRVILYSYYKNITLYMTQFWYSFQNAFSGEVIYESWTLSFYNVLFTVLP
FT                   PFAMGIFDQFISARLLDRYPQLYQLGQRGIFFKKHSFWAWILNGFFHSLILYIVSELLY
FT                   YWDLPMENGHVAGHWVWGESLYTAVLGTVLGKAALITNVWTKYTFIAIPGSMALWLIFL
FT                   PAYGYAAPALGFSREYYGTIPVLFKSPIFYLMAIVLPCICLLRDYAWKYAKRMYYPQQY
FT                   HHVQEIQKYNVQDYRPRMEQFQKAIRKVRQVQRMRKQRGYAFSQADDGGQMRVLNAYDT
FT                   TRSRGRYGEMASSRPMA"
     atggccagcg gtaggcctcc tgggtcgcat ccagccgctg gccgcgatga cgacctgctg        60
     ctggattccg gacctatgta tagcaccggt caaggccccc ctgtgaatga cgaacaccta       120
     ttagaacgct acaacattga cgactccgaa caaccgtacg cccaaacaca accacgccct       180
     tccgtctcct acgataactt tgtcgggtct agcgtgcagc aaggcgcaac gcggcacaat       240
     gttgcttcgg ggccggcgca tccgcctgtc aaccccggtc tccattcaaa tgacccctac       300
     tccagtggca cgcgagatcg aacctactcc cagacctctg gattggacaa ttatcggcgg       360
     tactctttgg atgatttcga cgatgggcat tcaggttatt atgatcttga tgcggatgaa       420
     gaccgaattg ccagttcaca ccatgtccgc aaggcaaatg agcgcaatag cgtcctcgga       480
     ctcgggggcg gatttatggg aaaggcgaaa tacatgtttg gcatggggtc atcacaatat       540
     tcggaaatgg atcttccgtt gactgaatcg ggtgcaagaa gggcgacagt tggtagcgat       600
     gcttctccgg cgccgccccc gaagcaacgc aagaagttcc gcgcgtctga ccttaacatc       660
     ttttcacgca aggttgatcc ctcgacattg ggtccccgca tgatccaact caacaaccca       720
     ccagccaacg ccacccacaa gttcgtcagc aacttcgtat cgacggccaa gtacaacatc       780
     tttaccttta tccccaaatt cctcttcgag caattctcca aatacgccaa cctgttcttc       840
     ttgtttaccg ctgtcctgca acaaatccca aatgtgtcgc cgacgaatag gtacacaact       900
     atcgttccac tggctatcgt cttggctgta tcggcgatca aagagttggt agaagactac       960
     aaacggagaa tgtcggacag aggactgaat tactcaaaaa cccaagttct taagggatct      1020
     tcgttccacg aagcaaaatg ggtggatgtt gtggtcgggg atatagttcg ggttgaatcc      1080
     gagcagcctt ttccagccga cttggtatta ctggcgtcgt ctgagcctga aggtctatgc      1140
     tatattgaga cggcaaactt ggatggcgag accaatctca aagtcaaaca agccatcccg      1200
     gagactgcgc atctggtcag ccctagtgat ctgagtcgac tgagtggacg tgttcgatct      1260
     gaacagccaa atagcagctt gtatacttac gaagccacct tgactatgaa cgctggaggt      1320
     ggcgagaaag agttgccctt ggctccggat caactcctgc ttcgtggtgc cacgctacgc      1380
     aacactcctt ggatccatgg cattgtggtt tttagtggcc acgagacaaa actgatgcga      1440
     aatgcgacag caaccccgat caagagaaca gctgtggaaa ggacagtcaa cattcagatt      1500
     ctgatgcttg tcagcattct catcgttttg agtgtcatca gttctgtcgg tgatctcgct      1560
     attcggaaaa ctaggtcttc aacgcttgca tacctcggct atggggggtc ggtcaaattg      1620
     gtaaagcagt tctttatgga cattttcacg tactgggtgc tctattcaaa tttggtccct      1680
     atctccctct tcgtcaccat cgaaatcgtc aaatacttcc aagccttcct catcaactcc      1740
     gacctggaca tttactatga caaaaccgat accccagcca tctgccgcac atcctccctt      1800
     gtcgaggagc ttggtcaaat cgagtacatc ttctccgaca aaacaggtac tcttacctgc      1860
     aacatgatgg agtttaagca agttagcatt gccggtgtcc aatatggcga tgatgtccct      1920
     gaagatcgac gtgccaccgt ggaggatggg gctgaaattg gtattcatga cttcaaaaca      1980
     ctcaaaaaga accttcaatc gcacccaagc cagaacgcta ttcgcgaatt cctcactctc      2040
     cttgccacct gtcacactgt tattcctgag cgaaatagcg aggacccgaa tgtgatcaag      2100
     taccaagcag catcgcccga cgagggagcc ttggtggacg gagcggcctc gctgggtttc      2160
     cgattcacta accgaagacc gagatcggtg atctttgagg ttggtgggca ggagcttgaa      2220
     tacgaactgc tagcagtctg cgagttcaac tccactagaa aacgaatgtc cactatcttc      2280
     cggtgtcctg atggaaaggt ccgcgtctac tgtaagggtg ctgacacggt cattctcgag      2340
     cggttacatc ccgataaccc taccgtggaa gcaactcttc agcacctaga ggagtatgcc      2400
     tcggatggtc tacggacgtt gtgtctggct atgcgggaag tcccagaaaa cgagttccag      2460
     caatggcacc agatttatga caaggcttcg accactgtcg atggcaatcg tgctgatgaa      2520
     ctggacaaag cggccgagct gatcgaaaag gatttttatc ttcttggcgc cacggctatc      2580
     gaggatcgct tgcaggatgg tgttccggat accatccaca ccctccagac tgcaggcatc      2640
     aagatttggg tcttgactgg tgatcggcag gagactgcaa tcaacattgg catgtcctgc      2700
     aaactcatct cggaagacat gacgcttctc atcatcaacg aggaaacgtc agaagccact      2760
     cgtgacagcc tgcaaaagaa aatggatgcc gttcagagcc aaatttccgc tggggactcc      2820
     gaacctttgg ctttggtaat tgacggccgg tcgttgactt ttgctttgga gaaagatatg      2880
     gagaagctgt tcttggatct ggctgtcatt tgcaaagccg ttgtttgctg tcgtgtgtct      2940
     ccccttcaaa aggccttggt cgtcaagctt gtcaagcgcc acaagaaggc tctcctcttg      3000
     gccattggtg acggcgccaa tgatgtgtcc atgattcaag ccgctcatgt cggagtcggt      3060
     atcagcggcg ttgaaggtct tcaagccgcg cgatctgctg atgtcgcaat tggccagttc      3120
     aggttccttc gaaaactgct tctggttcac ggagcatgga gctattctcg catcagtcga      3180
     gtcattctat attcgtacta taagaacatt acgctgtaca tgactcaatt ctggtattct      3240
     ttccaaaacg cattttcagg agaggttatc tacgaatctt ggacgctctc cttctataac      3300
     gtgctcttca ctgttctgcc tccattcgcg atgggaatct ttgaccagtt catctccgcc      3360
     cgattgctcg accgctatcc acagctgtac cagctgggcc agagaggcat cttcttcaag      3420
     aagcacagct tttgggcttg gattctgaat ggattcttcc actctctcat cctttacatt      3480
     gtctctgagc tgctctacta ctgggacctt cctatggaaa acggccatgt cgccggccat      3540
     tgggtctggg gtgaatctct gtacaccgcc gtgttaggta ccgttctcgg caaagccgct      3600
     ctaatcacca acgtctggac caagtacacc ttcattgcca tcccaggctc aatggcccta      3660
     tggctcatct tcctcccggc atatggttac gccgccccgg ctttgggctt ctcacgtgaa      3720
     tactacggca ccattcccgt gctcttcaag tcccccatct tctacctcat ggccatcgtc      3780
     ctaccctgta tatgtctcct acgtgattat gcctggaagt acgccaagcg catgtactac      3840
     ccacaacaat accaccacgt ccaggaaatc cagaaataca atgtccagga ttaccgtcca      3900
     cgcatggagc agttccaaaa agccatccgc aaggttcgcc aggtccagcg catgcgcaag      3960
     cagcgcggat acgccttctc ccaggccgac gatggcggcc agatgcgtgt tctcaatgct      4020
     tacgatacta cccggagtcg tgggcggtat ggtgagatgg ctagctctag gcctatggcg      4080
     tga                                                                    4083
//

If you have problems or comments...

PBIL Back to PBIL home page