(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE371

PENCW_10.PE371       Location/Qualifiers
FT   CDS_pept        complement(871784..873772)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950880"
FT                   /orf_name="Pc13g03710"
FT                   /product="Pc13g03710 protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91440.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR018944"
FT                   /db_xref="InterPro:IPR022312"
FT                   /db_xref="UniParc:UPI00018306B9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H216"
FT                   /transl_table=1
FT                   /translation="MIAWPDSSLKDKTEHVSIFSSQPPIFILPMHLSLEELDEVEGRVI
FT                   DYGGRLTYDIAEAGLVLGKVGRAKRAALELRTRGVWTEELIPSSASKSTGGAEPPVKRR
FT                   RTAQYDGTKDVPVEIIDLSTGSEGEDGTTNQHGSPKHPIPEGEAKAIKDSITVLKLEWL
FT                   DASITSGKCVSQDSFVVYRGRKIPSPPPTTGAENKQNLLQKSNQIIERAKQDAGLPTPR
FT                   TPPPDHIHARRSREPPDGYSQRHRPTLYRQTTSEHEKEVENAPPQPDWVRDHVVYACLR
FT                   SAPLHPPNEDFISQLVKIRRIRELTLDEIGVRAYSTSIAALAAYPHPIQRPSEILALPG
FT                   CNAKIADLFFQFQQHGGCEHTDDDGNVAAAEALETDPMLRVLNSFYQIWGVGAKTARDF
FT                   YQRGWRDLDDIVEHGWDTLSRVQQIGVKFYEEFLEGVPRAESEGIASVIRDHAGRVRGE
FT                   EGNGIECVIVGGYRRGKELSGDVDIVVSHRDDAVTRNLVVDVVASLEAERYITHTLALH
FT                   LTSSLREQQTLPFDGDDRRKFDTLDKALVVWQDPDFDDTTPGHNEHQGKKKNPNIHRRV
FT                   DIIISPWRTVGCAVLGWSGDMTFERDLRRYAKKARSLKFDSSGVRDRVSGRQVDLERDG
FT                   ETWEEREKLVMEGLGIGWRPPEERCSR"
     atgatcgcat ggccggactc ttccctaaag gacaagaccg agcatgtctc catcttctcg        60
     tcccagccac ccatcttcat tttgccaatg catctctccc tggaggagct agacgaggtt       120
     gaaggccggg tgatagacta tggtgggaga ttgacgtacg acattgccga agctggcctc       180
     gttctgggga aagtcgggcg cgcgaagcgt gcagcgctag aactgcgcac ccggggtgtc       240
     tggacagagg agctcatacc cagctcagct tcgaagtcaa ctggtggtgc cgagcctcct       300
     gtcaagcgca ggcgcacagc tcagtacgat gggacaaagg atgtcccagt tgaaattatt       360
     gatctcagta ctgggtctga aggcgaggac ggaaccacaa accagcatgg ctctccaaag       420
     cacccgattc cagagggaga ggcaaaggca ataaaggatt caatcacagt cttgaagctc       480
     gagtggctgg atgcctctat cacgtccggc aaatgtgtat ctcaggattc attcgttgtc       540
     taccgtgggc gaaagatccc ttctcctcct cctacgacag gggcagaaaa taagcaaaac       600
     ctcctacaaa agtcaaacca aatcatcgag cgtgcaaagc aggatgctgg tttaccaaca       660
     ccacgaaccc cccctccgga ccacatccac gcacggcgct caagagaacc ccctgatgga       720
     tattcacagc gccaccgacc aacgctgtat cgacagacga cctccgaaca cgaaaaggaa       780
     gttgaaaacg cacccccaca accagactgg gtccgagacc atgtcgtata cgcatgtcta       840
     cgctcagcac ctctacatcc tccaaacgaa gactttatct cgcaacttgt gaaaattaga       900
     cgaatccgcg aactcaccct cgacgagatc ggtgtgcgcg cctatagcac ctccatcgca       960
     gcattggcag catacccaca tcccatccag cgaccgagcg agatcctcgc tttaccaggg      1020
     tgcaatgcca agatcgcgga cttattcttc cagttccagc aacacggcgg ctgcgaacat      1080
     accgacgacg acgggaacgt cgccgctgcc gaagcactgg agacggaccc catgctccgt      1140
     gttctgaact cattctacca gatctggggc gttggcgcga agacagcgcg cgacttctac      1200
     cagcgtggat ggcgggatct ggatgatatc gtcgagcatg ggtgggatac gctttcgcgc      1260
     gtgcagcaga ttggagtgaa attctacgag gagttcctgg agggtgttcc ccgtgctgag      1320
     agcgagggga ttgctagtgt tatccgggat catgctggtc gggttcgggg agaagagggg      1380
     aacgggattg agtgtgtgat tgttggtgga tatcgtcgtg ggaaggaact cagtggtgat      1440
     gttgatattg tggtgagtca tcgtgatgac gcggtgactc ggaatctggt tgttgatgtt      1500
     gttgcgagtc ttgaggcgga acgttatatc acccatacgc ttgcgctgca tttgacttct      1560
     tcgctgcggg agcagcagac gttgcctttt gatggcgatg atcggaggaa atttgatacc      1620
     ttggataagg cgttggttgt ctggcaagat ccggatttcg acgacaccac tcctgggcat      1680
     aatgaacatc aggggaaaaa gaaaaatcca aatatccatc gtcgtgtcga tatcattata      1740
     tcgccttggc gaacggtcgg atgtgcggtg ctcggctggt ctggtgatat gactttcgag      1800
     cgagatctac ggcggtatgc gaagaaggca cgctcattga agtttgattc gagtggtgtc      1860
     agagaccgag ttagtggaag acaggttgac ctggaacgtg acggagagac ctgggaggaa      1920
     agggagaaac ttgtgatgga gggactgggg ataggctgga gaccaccaga agaacggtgc      1980
     tcgagatag                                                              1989
//

If you have problems or comments...

PBIL Back to PBIL home page