(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE372

PENCW_10.PE372       Location/Qualifiers
FT   CDS_pept        join(874634..874792,874874..874910,874995..875048,
FT                   875103..875219,875371..875411,875513..875561,
FT                   875633..875698,875827..875978,875996..876064,
FT                   876095..876236,876298..876347,876367..876469,
FT                   876548..876687,876776..876809,876850..876907,
FT                   876978..877559,877617..877716,877807..877924,
FT                   878484..878696,878780..878842,878922..878968,
FT                   879058..879132,879180..879557)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978324"
FT                   /orf_name="Pc13g03720"
FT                   /product="Putative uncharacterized protein Pc13g03720 "
FT                   /protein_id="CAP91441.1"
FT                   /db_xref="UniParc:UPI00018306BA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H217"
FT                   /transl_table=1
FT                   /translation="MSLRAGRGYNASMVASKRCEESTGKTHLTKKVDKATCVQVGPRGF
FT                   TRGLIGNMLANLLACPEADYDQPTDCPEGKACHGQARCDQPAVFPEAKRTDTVRLEVVD
FT                   RSGFVDQRADCRVAEDGHDWKWLNGVPRLIEVAADRPKAEARRSQTRSGVLVAQPADCP
FT                   EPKARHAQTGSAEARHGQTGSGGSWLIGVGIEVVDWGVLTHQPADCPKAEARHGQTGGW
FT                   LIGPADCPEAEARHGQTGSGGSWSIESADCPEAKARHGQTGSGGSWSIEVVDWGVLTDQ
FT                   SADCPEAKARHGQTAEARHGQTGSGGSWLIVVVDWGLVDWGLVDWGVLTDQPTDCPEAE
FT                   ARHGQAGPPRSDWGLVDWGWLTDQPADCPEAEAEARHGQTGSGGSWLIGVGIELTHRPN
FT                   AEARHVLIDQSADCPEAEARHGQTGLPIVLKPRPATVRLIVGDLTAWLGSLIAQPADCP
FT                   EAEARHGQTGSGGSWLVEVGIEVVDLGVLTHQPADCPEAEARHGQTGSGGSWLVEVGIE
FT                   VVDLGVLTHQPADCPEAEARHGQTGSGGSWLIGVGIEVVDWGVLTHQPADCPEAEARHG
FT                   QTGSGGSWLIGVGIEVVDWGVLTDQSADCPEAEARHGQTGSGRSPPRSDWEWFIGGWLI
FT                   EMDRVVDRRVHRGSAMIPKKQRRDSFPASATGLVRSSTHCEPKEPLGLITLEFSPATGL
FT                   VRSSTHCEPKEPLGLITLEFSPGMKIERNSGSTRHSSLEGDRGGQCSWWMVLRHDQDGR
FT                   SMVEGDHGGMTTMEGPWWMGSWWKVSMVDGMTKMEGPWWMGSWWKGSKVQGGWGQGPRS
FT                   MLGRVMMEGPEVTVVEGGILKSGGGISEKKKRCGGEKERRRENLGKRGYLYFFQWLKDR
FT                   KALGSATSSDKMGRNAGEPIETRRDTRNLPGRSFPTGPGCLLGYIHPWTCRGYAMEDIW
FT                   ILRTVHFENTNQIILARM"
     atgtcgttga gagcaggacg aggatacaac gcttcgatgg ttgctagcaa gagatgcgag        60
     gaaagcaccg gtaagacgca tctgaccaag aaggtcgata aagccacttg tgtgcaggtt       120
     ggaccgcgag gattcacgcg agggctgata gggaacatgc tggcgaacct gttagcttgc       180
     cccgaggcag attatgacca gcctaccgat tgtcctgaag gcaaagcctg ccatggtcag       240
     gctagatgtg accagcctgc cgtttttcct gaggccaaga ggaccgacac ggtgaggctg       300
     gaagtggttg atcgaagtgg atttgttgac cagcgtgccg actgtcgtgt agccgaagac       360
     ggccacgact ggaagtggtt gaatggggtt ccaaggttga ttgaggtggc tgccgatcgt       420
     cctaaagccg aagcccgccg cagtcagact agaagtggtg tattggttgc ccagcctgcc       480
     gattgtcctg aacctaaagc ccgccacgcc cagactggga gtgccgaagc ccgccacggt       540
     cagactggga gtggtggatc atggttgatc ggggtgggga tcgaggtggt ggattggggt       600
     gtattgactc accagcctgc cgattgtcct aaagccgaag cccgccacgg tcagactggg       660
     ggttggttga ttgggcctgc cgattgtcct gaagccgaag cccgccacgg tcagactggt       720
     agtggtggat cgtggtcgat cgagtctgcc gattgtcctg aagccaaagc ccgccacggt       780
     cagactggta gtggtggatc gtggtcgatc gaggtggttg attggggtgt attgactgac       840
     cagtctgccg attgtcctga agccaaagcc cgccacggtc agactgccga agcccgccac       900
     ggtcagactg gtagtggtgg atcgtggttg atcgtggtgg ttgattgggg gttggttgat       960
     tgggggttgg ttgattgggg tgtgttgact gaccagccta ccgattgtcc tgaagccgaa      1020
     gcccgccacg gtcaggctgg cccgccacgg tcagactggg ggttggttga ttggggttgg      1080
     ttgactgacc agcctgccga ttgtcctgaa gccgaagccg aagcccgcca cggtcagact      1140
     gggagtggtg gatcatggtt gatcggggtg gggatcgagc ttacccatcg ccctaacgcc      1200
     gaagcccgcc acgtattgat tgaccagtct gccgattgtc ctgaagccga agcccgccac      1260
     ggtcagactg gcctgccgat tgtcctgaag ccgaggcccg ccacggtcag actgatagtg      1320
     ggtgatctca ctgcttggtt ggggtcgttg attgcccagc ctgccgattg tcctgaagcc      1380
     gaagcccgcc acggtcagac tgggagtggt ggatcatggt tggtcgaggt ggggatcgag      1440
     gtggttgatt tgggtgtatt gactcaccag cctgccgatt gtcctgaagc cgaagcccgc      1500
     cacggtcaga ctgggagtgg tggatcatgg ttggtcgagg tggggatcga ggtggttgat      1560
     ttgggtgtat tgactcacca gcctgccgat tgtcctgaag ccgaagcccg ccacggtcag      1620
     actgggagtg gtggatcatg gttgatcggg gtggggatcg aggtggtgga ttggggtgta      1680
     ttgactcacc agcctgccga ttgtcctgaa gccgaagccc gccacggtca gactgggagt      1740
     ggtggatcat ggttgatcgg ggtggggatc gaggtggtgg attggggtgt attgactgac      1800
     cagtctgccg attgtcctga agccgaagct cgccacggtc agactggtag tggccgaagc      1860
     ccgccacggt cagactggga gtggtttatc gggggttggt tgattgagat ggatagggtg      1920
     gttgatcgac gcgttcaccg aggttccgcc atgatcccta aaaagcagag gagagacagt      1980
     ttccctgcgt cagccactgg actggttagg tcttccactc attgcgagcc aaaagaacca      2040
     ttggggttga taacgctaga gttctcacct gccactggac tggtgaggtc ttccactcat      2100
     tgcgagccaa aagaaccatt ggggttgata acgctagagt tctcacctgg tatgaagatc      2160
     gaacgcaact ctggaagtac tcgtcacagt agcttggaag gtgaccgtgg tggacagtgc      2220
     tcatggtgga tggtcctgag gcatgaccaa gatggaaggt ccatggtgga aggtgaccac      2280
     ggtggcatga ccacgatgga aggtccatgg tggatggggt catggtggaa ggtgagcatg      2340
     gtggatggca tgaccaagat ggaaggtcca tggtggatgg ggtcatggtg gaagggatcg      2400
     aaagtccaag gtggatgggg ccaaggtccg aggtccatgt tgggtagggt catgatggaa      2460
     ggtcctgagg tgaccgtggt ggaaggtggg atcttgaaaa gtggaggtgg gatctcagaa      2520
     aaaaagaaga gatgtggagg agagaaagaa agaagaagag aaaatctggg gaagaggggg      2580
     tatttatact ttttccagtg gctgaaggac aggaaagcac tggggtcggc gacgagttct      2640
     gacaaaatgg gaaggaacgc gggtgaaccc atagagacac gtagagacac gcgtaacctt      2700
     ccaggtcgta gtttccctac gggccctgga tgcttacttg ggtacataca cccgtggacc      2760
     tgtcgaggct acgcgatgga agatatatgg atattaagaa cagttcattt cgagaatacc      2820
     aaccagatta tactagctag gatgtag                                          2847
//

If you have problems or comments...

PBIL Back to PBIL home page