(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE373

PENCW_10.PE373       Location/Qualifiers
FT   CDS_pept        join(complement(881135..881341),complement(881071..881081),
FT                   complement(880930..881002),complement(880789..880874),
FT                   complement(880460..880738),complement(880251..880396),
FT                   complement(879564..880189))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000236991" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978325"
FT                   /orf_name="Pc13g03730"
FT                   /product="Pc13g03730 protein"
FT                   /function="metal ion binding"
FT                   /biological_process="metal ion transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91442.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0030001"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniParc:UPI00018306BB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H220"
FT                   /transl_table=1
FT                   /translation="MSGFNELVDTDLRGLDSDRKWSLQPLLRSAERSHSKMPGIRKIPL
FT                   RAIGIIAFIALLNIIVWVAAAIVLSYHHSLVSTAALAYSLGLRHAFDADHISAIDLMTR
FT                   RLLATGQKPVTVGTFFSLGHSTIVIITSIVVAATAAAVSERFDSFSTVGGIIGTSVSAA
FT                   FLILLGLMNAYILYKLVKQMEKVFNLPEGHEDEAWKIEGGGILFSVLKKMFKLIDRSWK
FT                   MYPLGILFGLGFDTSSEIALLGISSIEAAKGTSFWVILILPALFTAGMCLLDTIDGALM
FT                   FSLYIQPAANFLPQKPTSDVSDTSSTATDPDELPQSQDNHRDPVAFLYYSIVLTTLTVI
FT                   VAIVIGIIQLLTLILNVTDAKGKFWDGVQVAGDYYDAIGGGICGCFIVFGLLSVLVYKP
FT                   WRRWMDQRHGKHVANDVERYTDDDISRGDAPGYGAIVTETSRTQHEGTATEVTGKGPAS
FT                   RVAVKETGESRLEDHIM"
     atgtcggggt tcaatgagct cgtagataca gacctgcgcg gtctagacag cgaccgcaaa        60
     tggagcctgc agccacttct tcgcagtgcg gagcgctcgc atagcaagat gcccggtatt       120
     aggaagattc cccttcgcgc cattggaatt attgccttta ttgcgttgtt gaatatcata       180
     gtttgggtgg cggcggctat tgtgctgagt taccatcatt cgctggtctc gacagctgcc       240
     ctagcctatt ctcttggatt gagacatgca ttcgatgcag accacatttc tgctatagat       300
     ctaatgacta gaagactcct ggcaacgggg caaaagcccg ttaccgtggg cacgttcttc       360
     tcgcttggcc actcaactat cgtgatcatc acatctattg tcgtcgcagc cacagcagca       420
     gcggtctcag aacgcttcga cagcttcagc acggtcggtg gaatcattgg tacctccgtc       480
     agcgccgcgt tcctgatcct gcttggtctt atgaatgcgt acatcctata taaactcgtg       540
     aagcagatgg aaaaggtctt caatctcccc gagggccatg aagatgaagc gtggaagatc       600
     gagggtggag gaatcctttt ctcggtcttg aagaaaatgt tcaagctgat tgaccggtcg       660
     tggaaaatgt atcccctcgg aattctgttc ggtcttggct tcgacacctc ctccgagatt       720
     gctctacttg ggatctcgtc catcgaagca gcgaagggaa catccttctg ggtgattctc       780
     attctcccgg ctctattcac agccggtatg tgtctcctcg acacaatcga cggagccctg       840
     atgttctccc tctacatcca accagcggcc aacttcctcc cgcaaaagcc aacaagcgac       900
     gtctcagaca cctcatcaac agccaccgat ccggacgagc ttccacaatc acaagacaac       960
     caccgtgacc cagtcgcatt cctatattac tcaatcgtgc tgaccacact aaccgtcatc      1020
     gtggcgattg tgattggcat aatccagctg ctcactctca tcctgaacgt tacggatgcc      1080
     aaaggcaaat tctgggacgg cgtgcaggtt gctggtgact actacgatgc tattggcggt      1140
     ggtatttgtg gttgctttat tgtctttggt ctgttgagcg ttctagtcta caaaccatgg      1200
     cgcagatgga tggatcagcg acatgggaag catgtcgcca atgatgtgga gaggtatact      1260
     gatgacgata tttctcgtgg cgatgctcct ggctacggtg ccattgtgac tgagaccagt      1320
     cgaactcagc acgagggtac agctactgag gtcactggga aggggcctgc gtctcgggtt      1380
     gctgttaagg agactggaga gtcgagactt gaagaccaca tcatgtag                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page