(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE374

PENCW_10.PE374       Location/Qualifiers
FT   CDS_pept        join(complement(882922..883629),complement(882466..882759))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214217" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950881"
FT                   /orf_name="Pc13g03740"
FT                   /product="Pc13g03740 protein"
FT                   /protein_id="CAP91443.1"
FT                   /db_xref="UniParc:UPI00018306BC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H221"
FT                   /transl_table=1
FT                   /translation="MGGMRLPRPTGIYVPSSPRTLTNDMISPPLSPEFSFDSETVTPSL
FT                   LPALEYISSKLQQRMMHVTLLIGRGKPYPTGQPSDLMIIPIHTIEPQAWRVLERAIAKA
FT                   SKKFSLGPGWTDAISRSQYERQANDHLVKQSILQNEVIFSQEGLTLLNMDRIYTFKRRM
FT                   CILSTRPFSRNNEQSMSSCIRLLHRIVADFSGRPFSKAFFHRIYEQLDVPDEQLTAVAV
FT                   AYKNVHNQDAIILPPKVERVLLKPKADPIPIRVKAERHREVKRSPIQTVRGRRHPPPSM
FT                   RGHNKRGPKTPLSASDVTPITRNEWNILVSQDIRVQPKVTKWTPSPTVLAAA"
     atgggtggaa tgcgtctccc ccgcccaacg ggcatctatg tccccagttc accaagaacc        60
     ctcaccaacg atatgatctc tccaccactc tctccagaat tcagcttcga ctccgagact       120
     gtcacaccat ccctactccc agctctagaa tacatctcca gcaaactcca acaaagaatg       180
     atgcacgtca ccctcctcat cggccgcgga aagccctacc cgaccggcca accctccgac       240
     ctaatgatca tccccatcca cacaatcgag ccccaagcat ggcgagtact cgagcgcgcc       300
     attgctaaag cctcgaaaaa gttctcactc ggccccggct ggaccgacgc catcagccgc       360
     agccagtatg agcgccaggc aaacgatcac ctcgtcaagc agtccattct ccagaacgaa       420
     gtcatcttca gccaggaggg tctaactctc ctaaacatgg accgtatcta taccttcaag       480
     cgccgcatgt gcatcctctc tacccgcccc ttttcccgca acaacgaaca atcaatgtcg       540
     tcctgcatcc ggctactcca ccgcatcgtc gcagatttct ccggtcgccc tttcagcaaa       600
     gctttcttcc accgcatcta tgagcaactc gatgtcccgg atgagcagct cactgccgtc       660
     gcagttgcgt acaagaatgt ccacaaccag gatgctatca ttcttccccc caaagtcgag       720
     cgagttctct tgaagcccaa ggccgatccg atccctatcc gagtgaaagc tgaacgccat       780
     cgcgaagtga agagatcgcc catccagact gtgcgtggtc ggagacaccc tccaccatcg       840
     atgcgagggc acaataagcg tgggcccaag acgcctcttt ctgcgtcgga tgttactccc       900
     atcacgcgga atgagtggaa tatccttgtc agccaggata ttcgtgtgca acctaaggtt       960
     actaagtgga ctccgtcgcc gaccgtgctg gccgctgctt ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page