(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE375

PENCW_10.PE375       Location/Qualifiers
FT   CDS_pept        join(complement(885890..886021),complement(885669..885816),
FT                   complement(885456..885589))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978326"
FT                   /orf_name="Pc13g03750"
FT                   /product="Putative uncharacterized protein Pc13g03750 "
FT                   /protein_id="CAP91444.1"
FT                   /db_xref="UniParc:UPI00018306BD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H222"
FT                   /transl_table=1
FT                   /translation="MSAKLNPGEMCLFGVWAFEPRRFAYGSANPYLSWRVCAWPGRIKN
FT                   WPGVAQVALVSRLSEQRYIRGVKASSISATYLQNIFWHTPSAEEVDIPVGMPSINSKFL
FT                   NPFATFATSFCTGECPNAHCSETKSDGGDKRQG"
     atgagcgcta agcttaaccc gggcgagatg tgcctgtttg gagtctgggc atttgaacca        60
     agacggttcg cgtatggttc agccaatcct tatctctctt ggcgggtgtg cgcgtggcct       120
     ggtcgtatca agaattggcc tggggttgcc caagtggctt tggtgtcaag gttgagtgaa       180
     caaaggtaca tacgaggcgt caaggcgtcc tcgatctctg ctacttacct acaaaatata       240
     ttctggcata ctccatctgc tgaagaagtc gatattcccg tggggatgcc gagcataaat       300
     agcaagtttt tgaatccttt cgccaccttt gctacttcct tctgcaccgg tgagtgccca       360
     aacgcgcatt gctccgagac aaagtccgat ggaggagata aacgccaagg ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page