(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE376

PENCW_10.PE376       Location/Qualifiers
FT   CDS_pept        join(887007..887163,887214..887271,887338..887344,
FT                   887397..887557,887607..888936)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978327"
FT                   /orf_name="Pc13g03760"
FT                   /product="Pc13g03760 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91445.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00018306BE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H232"
FT                   /transl_table=1
FT                   /translation="MEKSIKAEEYPDHTVAREFSEDGKIEQGQSGLNDPNHVELHRALK
FT                   ARHITMIAIGGAIGTGLIIGTGEALAKAGPGAILISYAWVGFIVFLVMCALGEMAAWLP
FT                   LPSGFTGYAVRFVDPALGFTLGWTYWFKYIILSPNQMTAGAMVISYWIPPEKVNAGVWI
FT                   TIFLVIVVAINYFGVKFFGEFEFWLSSFKVIVILGIILMSFILMLGGGPDHDRKGFRYW
FT                   KEPGAFNTYKMDGAPGRFLAFWSTMVSATFAYLGTELVGVTVGEAQNPRKTIPRAIKLT
FT                   FYRILVFYVTSVLLVGTLVPYNSPKLLFALSDDNKKKGSAAASPFVVAIELAAIPILPH
FT                   ILNACILLFVFSAANSDLYIATRTIYGLAREGKAPKIFARTDRRGVPVPALAISSIIAL
FT                   LGYMNVSSDSKTVFKYFVNLVTIFGLLTWISILVTHIYFVRARKAQGVPEESLAYKAPL
FT                   GVAGSYFALGFCILIAFTKNFDVFIHNPKTYGNFDYKNFITAYLGIPLYLIMIFGYKFA
FT                   TGSKGVDPMTADLFTGKDEIDREEALYLARKEAETEKHNNAGWFYRTFVSWLF"
     atggagaagt ctatcaaggc cgaggaatac ccggaccaca ctgtcgcgag agagttcagt        60
     gaggatggca agattgagca aggtcagagt ggtctgaacg acccaaacca tgtcgagttg       120
     caccgtgcgc tcaaggcgag acatattact atgattgcca tcggtggtgc tattggtact       180
     ggtttgatca ttggaacggg agaagctctt gcaaaggctg gccccggtgc aatcctcatc       240
     tcttatgctt gggttggctt catcgttttc ctggtcatgt gtgctcttgg agagatggcg       300
     gcttggctgc cattgccctc tggtttcact ggttacgccg tccgattcgt tgatcctgct       360
     cttggcttca ccctcggctg gacgtactgg ttcaagtata tcattctatc accaaaccaa       420
     atgactgccg gtgcaatggt catatcatac tggatacctc cagagaaggt caacgctgga       480
     gtatggatta ccatcttcct ggtaattgtc gtcgccatca attacttcgg tgtgaagttc       540
     ttcggtgaat ttgagttctg gctgtcctcc ttcaaagtca ttgtaattct cggcatcatc       600
     ctcatgtcct tcattctcat gcttggtggt ggaccagacc atgaccgtaa gggtttccgc       660
     tactggaagg aacccggtgc tttcaacacc tataagatgg atggagcacc tggtcgattc       720
     ttggcttttt ggtcgacaat ggtctccgca acattcgcct acctgggcac tgagctagtt       780
     ggagtgacgg tcggcgaggc acagaacccc cgcaagacga tccctcgcgc gatcaaactg       840
     accttctacc gaatcctggt gttttatgtg acgagcgtac tcctcgttgg tacacttgtt       900
     ccatacaact ccccgaaact tctcttcgcc ctttcagacg acaacaagaa gaagggctca       960
     gccgcagctt cacccttcgt ggtcgccatc gagctggccg ccatcccaat cctgccccac      1020
     atcctgaacg cctgtatcct actcttcgtc ttctcagcag ccaactccga tctgtacatc      1080
     gccacccgta cgatctacgg cctggcccgc gaaggcaaag cccccaagat cttcgcccgc      1140
     accgaccgcc gcggcgttcc cgtccccgca ctggctatct catccataat tgccttactg      1200
     ggctacatga acgttagcag cgactccaaa accgtgttca agtacttcgt gaacctcgtc      1260
     accatcttcg gtctcctcac ctggatctcg atcctggtca cccacatcta cttcgtgcgc      1320
     gcgcgcaaag cacagggtgt tcccgaggaa agcctggcct acaaggctcc cctcggcgtc      1380
     gcaggctcat acttcgctct gggattctgc attctcatcg ctttcactaa gaacttcgac      1440
     gtcttcatcc acaaccccaa aacatacgga aacttcgact acaagaactt catcaccgct      1500
     tatctcggta tcccgctata cctcattatg atctttggat acaagttcgc gaccggcagc      1560
     aagggtgttg accccatgac agccgatctc ttcaccggaa aggacgagat tgatcgcgag      1620
     gaggcgctgt atctcgccag gaaagaggct gagacagaga agcacaacaa tgctggctgg      1680
     ttctaccgga ctttcgtctc ctggcttttc tga                                   1713
//

If you have problems or comments...

PBIL Back to PBIL home page