(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE377

PENCW_10.PE377       Location/Qualifiers
FT   CDS_pept        join(complement(890839..891213),complement(889594..890787))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214206" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950882"
FT                   /orf_name="Pc13g03770"
FT                   /product="Pc13g03770 protein"
FT                   /function="metallocarboxypeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP91446.1"
FT                   /db_xref="GO:0004181"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniParc:UPI00018306BF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H233"
FT                   /transl_table=1
FT                   /translation="MRLFSPILVASTLIPLISAVPAGSSITPPPPLQPSYFTHSSPRPW
FT                   ARLRDWIIGSIWDIDHKHRSSKHSSPPSNIHDRYGSDVVLRFHLRQPDEAEALASASQV
FT                   LFLDIWAITSEFVDIRLADDMIPSLLDLLPLTLRTSYTPLMDNLADEIYASYPSRHRSD
FT                   SDFKSGLASAELKTISNCDLFFQEYQPLSVITQWMRLMASMFSSHVRMTSVGVSYEGRD
FT                   IPALRLGTSHNTETTSGPRKTILIVGGSHAREWISTSTVTYVAYSLITHYGYSPAVTRL
FT                   LHEYDWVLIPTINPDGYVYSWESDRLWRKNRQPTGLPLCPGVDLDRAWDYEWDGESTRS
FT                   NPCSENYAGAEPFEALESQRLAQWAQNQTAHGGAEIVGFLDLHSYSQQILYPYSYSCSS
FT                   VPPTLESLEELALGLAKAIRQTSHESYDVTSACEGILTQGAAAGITSGGSALDWFYHKL
FT                   HTRFSYQIKLRDRGSYGFLLPSEHIVPTGKEIFRALLTFGKFVWGEEASDISLEDMTGD
FT                   QIPLN"
     atgcgtcttt tttctcccat attggtcgca tcgaccttga tccctcttat ctccgccgtc        60
     cccgctggtt caagcatcac cccaccgcca cccttgcagc cttcctattt cactcattct       120
     agcccgcgcc catgggctcg actccgcgac tggataattg gctcgatatg ggatattgat       180
     cacaaacacc gctcttcaaa acattcctcg ccaccatcca atattcacga tcggtatggc       240
     agtgatgtcg tcctccgctt tcatttgcgc cagccggacg aggcagaagc attggcttcc       300
     gcctcgcagg tgctgttttt ggacatttgg gctataacct cggaatttgt agatatcaga       360
     cttgcagatg atatgatccc ttccttgctg gacctattac ctttaacact ccgcacctcc       420
     tacactcccc tcatggacaa cctcgccgat gaaatatacg cttcttaccc ttctcgtcac       480
     cgtagcgact cagacttcaa atcgggactt gcttcggctg agctgaagac gatatcgaac       540
     tgcgacctat tcttccaaga ataccagcca ctctcggtca tcacgcaatg gatgcgcttg       600
     atggcatcaa tgttctcctc gcacgtacgg atgaccagcg tgggagtctc ctacgagggt       660
     cgcgatatcc cagcattgcg actcggtacc tctcacaaca cagaaaccac atcgggtcct       720
     cggaagacaa tccttatcgt cggcggtagt catgccaggg aatggatcag tacctccact       780
     gtaacatatg tcgcatacag tctcatcact cattatggct attcacccgc cgtaacacgg       840
     ttgctgcatg aatacgactg ggtcttaatt ccaactatca atcccgacgg atacgtctac       900
     tcatgggagt cagaccgtct atggcgcaag aaccgccagc caacgggtct tccactatgc       960
     ccgggtgtcg acctagaccg cgcctgggac tacgagtggg acggcgagtc gactcgctcg      1020
     aacccgtgtt cagagaacta cgccggcgca gagccattcg aggcacttga atcgcagcgt      1080
     ctggcgcagt gggcccaaaa tcagacggcg catggcggcg ctgagatcgt aggcttcctc      1140
     gacttacatt cctactccca gcagattcta tacccttact cgtactcctg ctcatccgtg      1200
     ccccccaccc tcgagagtct cgaggagcta gcgttgggtc tggctaaggc aatccgtcag      1260
     acctcccatg aatcgtacga cgttacctct gcgtgcgagg ggatcctcac tcaaggtgca      1320
     gctgctggga ttacctcggg cggcagcgcg ttggattggt tctaccataa gcttcacacc      1380
     aggttctcgt accagattaa gctgcgcgac cgcggtagtt acggattcct tttgccttcg      1440
     gagcacattg ttccgacggg gaaggaaatt ttccgtgctc tattgacatt cggcaagttt      1500
     gtctggggcg aggaggcgtc ggatatcagc cttgaggata tgacgggcga tcagatacct      1560
     cttaactga                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page