(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE378

PENCW_10.PE378       Location/Qualifiers
FT   CDS_pept        join(892017..892383,892452..896281)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214195" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129524"
FT                   /orf_name="Pc13g03780"
FT                   /product="Pc13g03780 protein"
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91447.1"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000183077D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H234"
FT                   /transl_table=1
FT                   /translation="MHWKGLRLVADGKRQSTMEPQGQSRRSEHLPRPYPPAEPRLSESI
FT                   PRTPGLSESVNPELPAPDDNGSNHGVAQPDFAGPSSDRSSVRHKRFSFMRLRHASDPQL
FT                   SKSYVRAGQDTPPVPSLPPPKIITTAPTSQELDQPVKQRPRLSFRPSSRKQSMEEMSRR
FT                   SMEQPAKPRRRGQGSTDSQVTDSTLAMSQSITEEPGRLSTNSLRGNPQPNDSQRSSVID
FT                   PRFSESSRSDQSYGDQTITRSISPRDGQSATAAKRFRMPRLKRTRSPLFPLPPKVSHPT
FT                   GVVDNRPKFAPADTPKSETLDGHDHVSPLPSPSRSTVGLAASSNVTPLFRNDSTNSARS
FT                   VRSNPSLKNRGRSSTMGSLAENHDDLSIPPYLASSARTSTSTSGRKSFGDMFNITQRLR
FT                   QNSSPPSPRHGSPTIGGASTPISKQELPTIPKREESDTPASYLTRLEENIPRGMIAGVL
FT                   AQSDEEFYKVCLRKYMRTFSYFGDPLDMSIRKLLMEVELPKETQQIDRFVQAFADRYHE
FT                   CNPGIFTAPDNAYFIAFSLLILHTDVFNKNNKRKMQKADYVKISRSEGISEDILECFYE
FT                   NISYTPFIRVEDANLPDRHLAKPRRTLFKSTSSENLARIAREPVDPYSLILEGKLGSLR
FT                   PSLKDVMDLEDTYNHFGTAGPPDMDALHQAFTKSGILQIISLRSRPDAFMPASLGSPLD
FT                   SNPGLVDIKVAKVGLLWRKDPKKKKARSPWQEWGAILTFSQLYFFRNVNWVRSLMAQHE
FT                   AYVKNGRRGTLVFKPPLAEFKPDNIVSTGDTVALLDSSYKKHKHAFIFVRHNALEETFL
FT                   ASTESEMNDWLAHLNYAAAFRTTGVRTKGMIATNYEGQRYRKSQRLSSISSQKSHQSTD
FT                   IEPHSPSIDTDIVAEFVAARQQLMSQKIRERNEKLAMSQKQLDDLLQNARHLQVLTPLH
FT                   ARARENVIMAAGRLSAKIKWVRQDIWRSKCYRQVLLRDLGEDEEAVESRVGSVAEPTPS
FT                   HSDGARLASLSGPSVTSEPSVEKAGSIVHTVSSADTPEPNMAQTEQPSEAGLLPKPSND
FT                   ELRRPSIPGSATSADIARVGRRRSAVALPERAKSYSPDPATIKLEREASVLSRASRWDG
FT                   ASLASRTSKLTTPVSFDDGEERVLREAGLLELPASPSTQKDDETASNGLPGKDTEGETN
FT                   PKDKSDRPSRVRRSLHRTLRDSHAHRTHSHSKKKRGSVSSIGQEEDDQVSGDGEVLPRK
FT                   APSFTVHGKKASIVTFGSEWQNMPPEERLKLRKPTPHEESRVSDPAILDSGESIMTDRS
FT                   PERPHSARRMSTATGLSVRTSDDPADFTDAQEEQEEQPEEDIGAPGSPVVTSLPTPHPL
FT                   DTQHTPYSPSSTIYGHLSAPRHDGSPSPSPSSTSISERIVDTPSSENLREQAVGA"
     atgcattgga aaggactgcg tctcgtggcc gatggcaaga ggcagagcac catggagcct        60
     caaggccaat cccgtcgcag tgaacacctt cctcgcccct acccccccgc cgaacctaga       120
     ctatccgagt caattcctcg cacacccgga ttatcagaaa gcgtgaatcc agaacttccg       180
     gcaccggatg acaacggttc aaaccatggg gtagctcagc cggactttgc aggaccatcc       240
     tcggaccgtt ccagcgtacg ccacaagcga ttcagcttca tgagactacg gcatgcatct       300
     gatccccaac tatccaagtc ttacgtcagg gcgggccagg acactcctcc ggtcccttcc       360
     ttacctcctc ccaaaattat tactaccgcc ccgaccagtc aagagctcga ccagccggtg       420
     aaacaaagac ccaggctcag ctttcgacca tcgtcgcgaa aacagtccat ggaggaaatg       480
     tctcggagat cgatggaaca acccgcgaag cctcgtagaa ggggccaggg atcaaccgac       540
     tcccaggtta ccgactcgac acttgccatg tcccagagca ttaccgaaga gcctggacgc       600
     ttgtcaacaa actcacttcg ggggaacccg cagcctaacg actctcagcg ctcgtcggtg       660
     attgatcccc ggttttccga atcgtctcgg tcagaccaga gctatggcga ccagacaatc       720
     acccgaagca tttcccctcg tgatggtcaa agtgccactg ccgcaaagcg attccgtatg       780
     ccacgcttga aacgaacccg gagccctctc tttcctttac cccccaaagt ctcgcacccg       840
     actggagttg tggataatcg accgaagttc gccccagcag atactccaaa atctgagact       900
     ttggatggcc acgaccatgt ttcaccacta ccctcgccat ctcgttccac cgtcgggctc       960
     gctgcctcct caaatgtaac accgctattt cgaaatgatt cgacgaattc cgctcgctca      1020
     gttcggtcca atccctcttt aaagaaccga ggacgttcat ctaccatggg atccctggct      1080
     gagaaccacg acgacttgtc cataccgcca tatttggcat cttcggcacg cacctccact      1140
     tcgaccagtg gccgcaaaag ttttggtgat atgttcaata tcacgcagcg attgagacaa      1200
     aactcgtccc cgccctctcc tcgtcacggt tcgcccacga taggtggcgc ctccacccct      1260
     atctcaaagc aagagctacc gacaatccca aagcgggaag aaagcgatac acccgcttcg      1320
     tatctgaccc gtttggaaga aaatatacct cgtggcatga ttgctggtgt cctcgctcag      1380
     tcagacgagg aattctacaa ggtttgtctc cgaaaataca tgagaacctt ctcatacttc      1440
     ggtgacccac tcgacatgtc aattcgcaag cttttgatgg aagtcgagct tccgaaagaa      1500
     acacagcaga ttgatcgttt cgtgcaagca tttgctgatc gctatcatga atgcaaccca      1560
     ggcatcttca cagccccgga taacgcatat tttattgcat tttcactttt gattcttcac      1620
     accgacgttt tcaataagaa taacaaacgg aagatgcaga aggcggacta tgtcaagata      1680
     agtcgcagtg agggaatctc agaggacatt cttgagtgtt tctatgagaa catctcatac      1740
     actccgttca ttcgtgtcga agacgccaat ctgccggacc gtcacttggc gaaaccacgt      1800
     cgcactctat tcaaaagcac tagttccgaa aatctggcac ggattgcacg ggagcctgtc      1860
     gatccctatt cgctcattct agagggcaaa ttaggatccc tgcgccccag cttgaaggat      1920
     gtcatggatc tggaagatac atacaatcat tttggaaccg ctgggccacc ggacatggat      1980
     gccctccacc aggccttcac caagtctggg atcttgcaaa ttatctctct gcgctctcgt      2040
     cctgacgcct tcatgccggc tagcttaggt agtccgctcg actcgaatcc cggtctggta      2100
     gatatcaaag tcgccaaggt cggcttgctt tggcggaaag acccgaagaa gaagaaagcc      2160
     aggtcgccct ggcaggaatg gggtgcgatt ctcacattct ctcagctcta cttcttccgc      2220
     aatgtgaact gggtgcgctc actcatggca cagcatgagg catatgtcaa gaacggccgt      2280
     aggggaaccc tcgttttcaa gccacccctt gctgaattca agccggacaa catcgtgtct      2340
     actggtgaca cagttgccct tctggactcg agttataaaa agcataaaca tgcctttatc      2400
     tttgttcgac acaacgcgct ggaagagaca ttccttgcga gcactgagtc tgagatgaat      2460
     gactggcttg cacatctcaa ctatgctgct gccttcagga ccactggtgt gcgcaccaag      2520
     ggcatgattg ccacgaacta tgagggacag cgataccgca agagtcagcg attaagctcg      2580
     atatcttcac agaagtctca ccagtccacg gacatagagc cccattctcc cagcatcgac      2640
     accgacattg ttgccgaatt tgttgctgcg cggcaacaat tgatgagcca aaagattcgg      2700
     gaaagaaacg aaaagctcgc gatgtcacaa aagcaactgg atgatcttct acaaaatgct      2760
     cgacacttgc aagtgctcac tcctcttcac gcccgggccc gcgagaacgt catcatggct      2820
     gcaggccgcc tgtctgccaa gatcaaatgg gtgagacagg atatctggcg gagcaaatgt      2880
     taccgccagg ttctcctgcg tgacctggga gaggatgaag aggcagtgga aagcagggtc      2940
     ggatcggtcg ctgaaccgac gccatcccat tcggacgggg cacgcctcgc atctctttcc      3000
     ggaccgtccg ttacatcgga gcctagcgtg gaaaaagccg gtagtatcgt gcataccgtc      3060
     tctagtgctg atacccctga gcccaatatg gcccagaccg agcagccctc ggaagctgga      3120
     ctgctgccta agccgtcgaa tgatgaattg cgtcgcccca gtatcccggg atctgccact      3180
     tcggctgaca ttgctcgtgt cggtcgccgg cgctctgctg tggcccttcc cgaacgtgcg      3240
     aagtcatact cacccgatcc agcgaccatt aaactggagc gtgaagcctc ggttctcagc      3300
     cgtgccagtc ggtgggatgg agctagcctg gcatctcgta catcgaaact gacaacgcct      3360
     gtcagcttcg atgacggcga ggagcgtgtt ctaagggaag ctggcctact ggagctgccg      3420
     gcgtccccat cgacacaaaa ggatgacgag accgcctcta acggactccc cggtaaagac      3480
     accgagggcg agacaaatcc gaaagataag agcgatagac ccagtcgcgt ccgtcgcagc      3540
     cttcaccgca ccctccgtga ttcgcatgct catagaaccc actctcattc gaagaagaaa      3600
     cggggctcag tttctagtat tggacaggag gaggacgacc aagtctctgg cgatggagaa      3660
     gtccttcctc gcaaagcccc tagtttcacc gtgcatggga agaaagcatc catcgtcaca      3720
     ttcgggtctg aatggcagaa catgcccccg gaagagcgcc tcaagctccg caaacccacc      3780
     cctcatgaag aatcacgggt atcagatcct gctatattgg acagcggcga gtcgattatg      3840
     accgatcgca gcccggaacg tcctcactcg gcccgcagaa tgagcaccgc cactggccta      3900
     agtgtgcgca ccagcgacga cccggcagac ttcacggatg cgcaggaaga gcaggaagag      3960
     cagccggaag aggatatcgg ggccccgggc tccccagtgg tcacctcgct cccgactccg      4020
     catcccctag acacccaaca tactccttac tccccttcat ccacaatata cggccatctt      4080
     tcggcaccaa ggcacgacgg ctccccctcc ccgtccccct cctctacatc aatcagcgag      4140
     cgaatcgttg atacgccgtc cagcgaaaac ctacgcgagc aggccgtagg cgcctga         4197
//

If you have problems or comments...

PBIL Back to PBIL home page