(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE38

PENCW_10.PE38        Location/Qualifiers
FT   CDS_pept        complement(90182..90601)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076506" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948693"
FT                   /orf_name="Pc13g00380"
FT                   /product="Putative uncharacterized protein Pc13g00380 "
FT                   /protein_id="CAP91107.1"
FT                   /db_xref="UniParc:UPI0001830DCA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H183"
FT                   /transl_table=1
FT                   /translation="MEEIVDIVRQIGRQQGENVYFRTCYALFKHLQDKAEQASQDLLHL
FT                   HQSGAFGSSDDEFYPVYQVAQELQVSVHELAEQALKAQLACEEFCQLDPSYSAREAFKF
FT                   TDTVHTAGKTEADASQGVCDSPRSMRFIMLPVNDL"
     atggaggaaa tcgtcgatat agttcgacag atcggacggc aacagggaga aaatgtgtat        60
     ttccgaacct gctatgccct tttcaaacac ctccaggata aggccgagca agcgtcccag       120
     gacctacttc acctacacca atccggtgct tttggttcct ccgatgacga attctacccc       180
     gtctatcagg tcgcacaaga gcttcaagtc tcggtgcacg aactggctga gcaggcactt       240
     aaggcgcagt tagcctgtga agagttttgc cagttggacc ccagctattc ggcccgcgaa       300
     gctttcaaat ttaccgacac cgtacacaca gccggaaaga ctgaagctga cgcatcccag       360
     ggtgtctgcg atagcccccg gtcgatgcgg tttataatgc taccagtgaa tgacctctaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page