(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE380

PENCW_10.PE380       Location/Qualifiers
FT   CDS_pept        complement(898483..899466)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214172" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129525"
FT                   /orf_name="Pc13g03800"
FT                   /product="Pc13g03800 protein"
FT                   /function="hydrolase activity"
FT                   /function="metal ion binding"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP91449.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="UniParc:UPI000183077F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H231"
FT                   /transl_table=1
FT                   /translation="MSKATLAVIAAASAATGAGVTALLFSGKPSKPQQETLSPTPTTQN
FT                   PKVPVPSTIPSPTLASKLATGPVDAAGILQYGFPGPIADELSSLPLHGAYDRRTRNPSW
FT                   VAEHITPESLRMNNADRKRSTFFEDTTIPAMFRAKLSDYFRSGYDRGHQVPAADAKWSQ
FT                   DAMDGTFALSNMSPQVGEGFNRDYWAHFENFCRDLAKRYPSVRIVTGPLYLPHRDPDGK
FT                   WRVNYEVIGNPPNVAVPTHFYKVIYAEDGTNSPTSKVALGAFVLPNARIANDKRLTDFE
FT                   VPLEAVERASGLEFGSKLDLSRRRRLCQEVSCSITVREFNNANKRS"
     atgtccaaag caactctggc tgttattgct gccgccagtg cagccactgg agctggtgtc        60
     actgcgctgc tcttctccgg caaaccctca aagccccaac aagagactct ctccccgaca       120
     ccgacaaccc aaaaccctaa ggtgccggtg ccttcaacca tcccaagccc aaccctagca       180
     tccaagctag ccaccggacc cgtggacgca gcaggaatcc tccaatatgg cttcccgggc       240
     ccaatcgccg acgagctctc ctcgctccca ttgcacggcg cctacgaccg acgcacacgt       300
     aacccatcct gggttgcaga acacattaca ccggaatccc tgcgcatgaa caatgccgac       360
     cgaaagagga gcactttctt cgaggacacg accatcccgg ccatgttccg cgccaaactg       420
     tccgactatt tccgctcagg ctatgaccgc ggacaccagg tgccagccgc agacgcgaag       480
     tggtcgcagg atgcgatgga cggtacattc gcactgagca acatgtctcc gcaggtcggc       540
     gagggcttca accgcgacta ctgggcgcac tttgagaatt tctgccgtga tctcgctaag       600
     cgatatccct ctgttcgcat cgttaccggc cccttgtacc tgcctcaccg tgacccggat       660
     ggaaagtggc gcgttaatta cgaagttatt ggtaacccgc ctaacgtcgc tgtgcccacg       720
     cacttctata aggttatcta tgccgaggat ggcaccaact cgccgacgag caaggttgcg       780
     ctcggtgctt ttgttctgcc caatgctcgc attgcgaatg ataagcgtct gactgacttc       840
     gaggttcctc tcgaggctgt tgagcgtgct tctggtttgg aattcggctc gaagttggac       900
     ctcagtcgtc gtcgtcgctt gtgtcaggag gtgtcttgct cgatcactgt gcgcgagttc       960
     aacaatgcca ataagcgttc ttga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page