(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE382

PENCW_10.PE382       Location/Qualifiers
FT   CDS_pept        join(complement(902888..903013),complement(902515..902619),
FT                   complement(902381..902470))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672463"
FT                   /orf_name="Pc13g03820"
FT                   /product="Putative uncharacterized protein Pc13g03820 "
FT                   /protein_id="CAP91451.1"
FT                   /db_xref="UniParc:UPI0001830780"
FT                   /db_xref="UniProtKB/TrEMBL:B6H223"
FT                   /transl_table=1
FT                   /translation="MLKLPTSGRPTAWSATTTSRLACQFRFSASYMAAGWLEDSAIAPP
FT                   RGDALSVDEICSVGTPWCKESDKVNYDPDSKQRNVVTARVLPIMTYHVPDIVLGRWQNL
FT                   TA"
     atgttgaagc ttcctacttc aggtagacca acagcttggt ctgcaacaac gacgtctcgc        60
     ttagcatgcc agtttcggtt tagtgctagc tacatggcgg caggttggtt ggaggattca       120
     gccatcgctc ccccgcgggg agatgctttg tctgttgacg aaatatgctc cgtaggaact       180
     ccatggtgta aagagtctga caaggtaaac tatgatccag attctaagca gaggaacgta       240
     gttactgccc gtgtactgcc aataatgaca tatcatgtgc ctgatatagt gttgggtcgc       300
     tggcagaatc ttaccgccta g                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page