(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE383

PENCW_10.PE383       Location/Qualifiers
FT   CDS_pept        join(903427..904204,904234..904370)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825159"
FT                   /orf_name="Pc13g03830"
FT                   /product="Putative uncharacterized protein Pc13g03830 "
FT                   /protein_id="CAP91452.1"
FT                   /db_xref="UniParc:UPI0001830781"
FT                   /db_xref="UniProtKB/TrEMBL:B6H224"
FT                   /transl_table=1
FT                   /translation="MNGQLPPYYALETILSELSEVPELSGFIVVKDNELNAIEKPAETI
FT                   TIIDFYRYSTAILDYVKSSNTDSLALHTEALDSWGTEIICILLTNLHAKSVPSPFCALL
FT                   SGFPFTKTWNRFVEYYLADPGVEFPREKFPDAKALAEATLRQFSRRNLRAVTRFGVGAI
FT                   IRPVEATYQDEFYRSLHTVLGYAMNVTSEWSPDGVGRIDFRLSSVRWGIELLREGDRLH
FT                   DHCQRFTTDGAYGKWIQQGLLEDWLVIDCRTSSPRSYAGTAHASIEIPDTKLWRAVFAP
FT                   DFSDVEVRDQYNQVVVDRFALTE"
     atgaatggac aacttcctcc ctactacgct ctggaaacca tattatcaga gcttagtgaa        60
     gtgccagaac tgagcggttt tatcgttgta aaagacaacg agctcaacgc cattgagaag       120
     ccagctgaga caattactat catcgatttc tatcggtata gtactgcaat tctagactat       180
     gtcaagtcta gcaatacaga ctctctcgcc ctgcacacag aagctcttga cagttggggt       240
     acagagatca tttgcatcct gctaacaaac ttgcatgcaa agtcagtacc atctcccttt       300
     tgcgctctct tatccggctt ccccttcact aagacatgga acaggtttgt agagtactat       360
     ctcgcggacc ctggagtcga gttcccacga gagaaatttc cggatgccaa agcacttgca       420
     gaagctacac tgaggcagtt ctctaggcga aacctgcggg ccgtaactcg gtttggtgtc       480
     ggtgctatca ttcgaccagt tgaagcaact taccaggacg aattttatcg ctctcttcat       540
     accgttcttg ggtacgctat gaatgtcact agcgaatggt cgccagacgg cgttggcaga       600
     atcgactttc gacttagcag cgtcagatgg ggaattgaac ttctacgaga aggtgatcga       660
     ctgcatgacc actgccagag atttacaacc gatggagcat acggaaaatg gatccagcaa       720
     ggcctactag aggattggct agtcattgac tgccggacat cgtcaccacg ttcatacgct       780
     ggaaccgctc atgcaagtat agaaattcca gatacgaagc tttggcgtgc cgttttcgct       840
     cctgattttt cggatgttga ggttcgagac caatacaacc aggttgtggt ggaccgtttc       900
     gctttaacgg aatag                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page