(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE384

PENCW_10.PE384       Location/Qualifiers
FT   CDS_pept        join(complement(910023..910473),complement(907667..909970),
FT                   complement(904935..907582))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950883"
FT                   /orf_name="Pc13g03840"
FT                   /product="Pc13g03840 protein"
FT                   /protein_id="CAP91453.1"
FT                   /db_xref="UniParc:UPI0001830782"
FT                   /db_xref="UniProtKB/TrEMBL:B6H225"
FT                   /transl_table=1
FT                   /translation="MVSSTAISCVEGFKSKESDQVIGRNVDAAFVTYAKRFSTHWNCVV
FT                   DAHTAKLVQDSPLIYSSPELGSLRQFLGVQDRPLQFILDSRAHSLAEGSFEWFNNTLYD
FT                   FSVGSSPAMLVSGGPGSGKSALAQWAVERLQQSAEHDSWNVIPYTIRADIPVATLPLRI
FT                   LKGVLHQMLDHSVSDKQTQEAILAEVARAAQGAIDGAGDDAVEASLWRGIRAGLATNIQ
FT                   YMFVVDGIDQIRGGHANAVAYLDRFCEILSEQNAGSKMIAFTRPLTSKVSSKGVHQLTL
FT                   QTSQTKTDLVAYVNKMLASSANFDTHKGNQLQAAVSAIVARSQGSFSWAEMAVSYAKQQ
FT                   KTLSQAVASIQALPQSMSELIDFHSKSLDFSQQGTVNVVSWLVAAERPLLVEEIEHLLN
FT                   VDPKGPSYSPNQSTSSYDILNALSPLVMTRDGVVSFAHTCIRDHVIKQAKSSGGQSKLS
FT                   IRDAHYDLLTRCLSSVHLNVREEVDISMDRLGIEERNHLFDKYVVLEYTARYWLSHLLS
FT                   SPLVTDDEEFQFNSSFWKIMPATVLFARLELTCRESQFTRSSVVELYRLASDIRRLVLG
FT                   EKSIALLQSLVLSARVSKLAHASHADETCYEAWKLSQELLGQSHPVTLSCSEMMVQSFS
FT                   ERGTITSQQEDIMKYLILTDSEITGVEFNQRLKYLGMIVSMYKSRNDNQSALFISKHFY
FT                   QQILQKYGTNSRQSSETADFLTSHFSTTGTDEMSRDIARTKYDNMVRTMEVTDERRISY
FT                   TLYMAKMYEDQGDLAHAQAVLSSLWAGLNSRDIDSVDMMDKKANVALVYYQFLRRQGRN
FT                   DESEVIIRELVADLEVTGIHSEEMMQRVHLLRAETREMLMYNLDRSLAILMWRYYKETH
FT                   QEYSEDSTALALSIAQSMANAVSIESASSLSSRDRKLLIELLDVISATSECAMAVLQHI
FT                   WPAVEQAKSHQKFSPELAPPAADLALVLAYCHFRRLHLEQATAVYENAFGSLISSAGVP
FT                   VPSVMAVAKAVVEFHETTYQFTNALTLLHTMSNFLAARLGEKHEHTIENMYSEAALATR
FT                   LEKNSEAKSIYQRIFNATSHQNTVSPEGMDAAIALINLYEKEMQWDSALHVYRSLWPTL
FT                   VVEDNKVDTYDHDLVDRMLEKTYLGYMSILTTHKRADFSERYRVASEYVMTCRHLHGAT
FT                   SEKTLNATLLFAELCESNDAHVDQAISLYKLPLETSEWVAPSQSSKGLDQMTTPLPITL
FT                   KHKLAQLFVRKHDSTVEARSLYTEEFQLAKKNQGYFSTTTLSWLRELALAHSRQGTSTS
FT                   VQQGNAILHAYSTDVLHAGGDTETIGDWARRIASIYLECGFIEGGNNLLDELRHRVVYG
FT                   SESSAVDLSDRRDAVFVAAFEEVFGRRASYDQIMAEMAREMRTSQAFSKSLSSHDFIPT
FT                   LITGHKLYNLQISQKRVRAANDTKDKLYDYFCSNLSATNVADKEIVQQFYQICLREVHR
FT                   ENCNMSILTTTTNLVRDLCNSSRFQEASILTGVLHSFLHLTDGLNNQESINTATQLCLY
FT                   LSGHKANKCTDEKTYQAISTKSKLLLQEIMATSKSMGIEMVDLPFNHLNDIITLLGQYE
FT                   MFDELEAILTQLWTSRIVQRTWTPDVVVWIGRRLVETRFCRGSVDSAIQLCRDICYNLR
FT                   QVWGSCDPVTLDMTKLLSALFTASENYQSAATLHEGILYDLLGDSGAVDHANGADTASQ
FT                   HMELLRRSQARLGAEQTSSRPSAHAELFQSVADRFGVQSEQIKSVGEANGGEQFGVWSK
FT                   PRRFSIDVEDMEEEGQTHRNHLRESSGAGLGGTGSQRRISVQAL"
     atggtcagta gcacagctat aagctgtgtc gagggattca agagcaaaga gtccgatcaa        60
     gtcatcggac gcaatgttga tgccgctttc gtgacgtacg ccaaacgctt ttccacccac       120
     tggaactgtg ttgtcgatgc ccacactgcg aagcttgtgc aggatagccc cctgatctac       180
     tcgtcgcctg agttgggtag tttgcgtcaa ttcctgggag tgcaggaccg ccctcttcag       240
     tttatcctcg actctcgcgc tcactcgctt gccgagggat cctttgagtg gttcaacaac       300
     acactgtacg atttcagtgt cggaagctcc cctgccatgc tggtttctgg tggtcctggc       360
     tcggggaaga gtgcactggc ccaatgggcg gtcgaaagac tacagcagtc ggctgaacac       420
     gatagctgga atgttatccc gtacaccatt cgtgctgata ttcccgtcgc tactttgcct       480
     ctgcgcatcc tgaaaggtgt ccttcaccag atgttggatc attctgtcag tgacaagcag       540
     acccaggagg ctatcctggc tgaagtggcc agggcagccc aaggcgcgat cgatggtgct       600
     ggggatgacg cggttgaagc aagcctttgg aggggtattc gtgctggtct tgctacgaac       660
     attcagtaca tgtttgtggt tgatggcatc gaccaaatca ggggtggtca cgccaatgcc       720
     gttgcctatc ttgatcgctt ctgcgagatt ctctccgaac agaatgctgg atctaaaatg       780
     atcgctttca cccggcccct gacttcgaag gtcagctcca aaggtgttca ccagcttacc       840
     ctgcagacct cccagaccaa gaccgatctc gtagcgtatg tcaacaagat gcttgcatct       900
     agcgccaact ttgacaccca caagggcaac cagcttcaag ctgctgtgtc tgccattgta       960
     gcccgctccc agggctcctt cagttgggct gaaatggcag tttcatacgc taaacagcaa      1020
     aagaccttga gccaggctgt tgcgtccatt caggccctgc cgcagtcgat gtcagaactc      1080
     attgacttcc actccaagag cctggacttc agccagcagg gtactgttaa tgtcgtttcc      1140
     tggcttgtag cagccgagag acccctgctg gtcgaggaga ttgagcattt gctgaatgtg      1200
     gaccccaaag gccccagcta ctcccccaac caatctacta gtagctacga catcttgaat      1260
     gctttgagcc cgctggtcat gactcgggat ggcgtggtct cttttgctca cacctgcatt      1320
     cgtgaccacg tcatcaaaca ggccaagtca tccggtggac agtccaagct cagtatcaga      1380
     gatgcacact acgacttgct caccaggtgt ctttcctcag tgcatctgaa cgtgcgtgag      1440
     gaggttgaca tttccatgga taggttgggc atcgaggaac gcaaccatct cttcgacaag      1500
     tatgtcgtct tggagtacac cgcacgctac tggttgtcgc atcttctctc atctccactc      1560
     gtcaccgatg acgaagagtt ccaattcaac tcaagcttct ggaagatcat gcctgcaacc      1620
     gtcctcttcg cacgcctcga gttgacttgc cgcgagtccc agtttactcg gtctagtgtc      1680
     gtcgagctct acagacttgc aagtgacatt cgccgattgg tcctcggcga gaaatccatc      1740
     gctctgctac aaagcttggt cctcagcgca cgcgtgtcca agttggcgca tgctagtcac      1800
     gccgatgaga cctgctacga agcgtggaag ctaagccagg agcttctcgg ccagtcacac      1860
     ccggttaccc tgtcatgctc cgagatgatg gtccagtcat tctccgagcg aggcacgatc      1920
     acctcgcagc aggaagacat catgaagtac ttgatcttga ccgactccga gattaccggg      1980
     gtggagttca accaacgcct gaagtacctt ggaatgattg tcagcatgta caagtctcgc      2040
     aacgataacc agtccgcgtt gtttatctcg aagcacttct accagcagat tcttcaaaaa      2100
     tacggcacga attcgcgcca gtcatccgag actgccgact tcttgaccag tcatttctcc      2160
     acaactggaa ccgacgagat gagccgcgac attgccagaa ccaagtatga caacatggtg      2220
     cgcactatgg aagtcaccga cgagcgccga atctcctaca ctctgtacat ggccaagatg      2280
     tacgaggatc agggtgattt ggctcacgct caggcagttc tgtcaagcct ctgggctggt      2340
     ctcaactcgc gcgatatcga ctcggttgat atgatggaca agaaggctaa tgtcgccctt      2400
     gtgtactacc agttcctccg ccgtcagggc cggaatgatg aatctgaggt catcatccgg      2460
     gaactggttg cagatctcga ggttactggt attcactctg aggagatgat gcagcgcgtg      2520
     caccttctcc gcgctgagac tcgggagatg cttatgtaca acctcgatcg ctccttggca      2580
     attctcatgt ggcgctacta caaggagacc caccaagagt actcggagga ctcaaccgct      2640
     ctggcactct caattgccca gagtatggct aatgccgtct ctattgagag tgcatcctcg      2700
     ctgtcttctc gggaccgcaa gctgctgatt gagctgctgg acgttatctc agccaccagt      2760
     gaatgcgcga tggcggttct gcagcatatc tggcccgctg tcgagcaagc caaatctcac      2820
     cagaagttct cgcccgagct ggcacccccc gcggcagacc tggctctggt gttggcctac      2880
     tgtcacttcc gcagactgca tctggagcag gctacagctg tttatgagaa cgctttcggt      2940
     tctttgatct cgtctgctgg tgtacctgtg ccgtccgtga tggccgttgc caaggccgtt      3000
     gtcgagttcc acgagaccac ctaccagttc accaatgcgc tgacgttgct gcataccatg      3060
     agcaacttct tggcggctcg tctcggggag aagcatgaac atacaattga gaatatgtat      3120
     tccgaggctg ctttggcaac tcgcctggag aagaacagcg aggctaagag catctaccag      3180
     cgcatcttca acgctacttc ccatcagaac acggtttctc cagagggcat ggacgctgca      3240
     attgccctca tcaacctcta tgagaaggag atgcagtggg attctgcttt gcacgtgtac      3300
     cgatctctct ggccgactct ggttgttgaa gacaacaagg tagataccta tgaccatgac      3360
     ctggtggacc ggatgctgga gaagacttac ctgggataca tgtctattct tactacccac      3420
     aagagggccg acttctctga gcgataccgc gttgcctctg agtatgtcat gacctgccgc      3480
     cacttgcacg gcgcaacaag tgagaagacg ctcaatgcta ccttgctctt tgccgagcta      3540
     tgtgagtcca acgatgcaca cgtcgaccaa gccatctccc tgtacaagtt gcctctggaa      3600
     accagcgagt gggtggctcc ttctcagtcg tcgaagggtc tcgaccagat gactacacca      3660
     ctgcctatca ccctcaagca caagctggca cagctgtttg tgcgcaagca tgattcaact      3720
     gtagaagccc gttccctcta cacagaagag ttccagctgg ccaagaagaa ccagggctac      3780
     ttctccacca cgactctctc ctggctccgt gaacttgctc tcgcccattc gcgacaggga      3840
     acgtctactt ctgttcaaca gggcaacgcc attctccacg cctactctac tgatgtgttg      3900
     catgctggtg gcgacaccga gacaatcggt gactgggctc gccggatcgc aagtatctac      3960
     cttgagtgtg gtttcatcga aggcggcaac aatctccttg acgaactccg ccaccgcgtg      4020
     gtgtacggct ccgaatcttc cgcggtggat ctgagcgatc gtcgcgacgc cgtgtttgtc      4080
     gctgcgttcg aggaagtctt cggcagacgt gccagctacg accagatcat ggccgagatg      4140
     gctcgtgaga tgaggacttc tcaggccttc tccaagagcc tctctagcca cgacttcatc      4200
     cccactctga tcactggcca caagctctac aatctccaga ttagccagaa gcgagttcgc      4260
     gctgccaacg acaccaagga caagctgtac gattacttct gctctaacct gtccgccacc      4320
     aatgtcgccg acaaggaaat cgtgcagcag ttctaccaga tctgtctgcg tgaggttcac      4380
     agagagaact gtaacatgag catcctcacg acaaccacca atctcgtccg tgacctgtgc      4440
     aactcctccc gcttccagga agccagcatc ctgacaggcg ttctgcactc cttcctgcat      4500
     ctgaccgacg gtctcaacaa ccaggagagc atcaacaccg ccactcagct ctgcctgtac      4560
     ctgagcggcc acaaggctaa caagtgcacg gacgaaaaga cctaccaagc catatccacc      4620
     aagtccaagc tactcctaca agagattatg gcaacctcaa agtccatggg catcgagatg      4680
     gtcgatctac ccttcaacca cctcaacgat atcatcaccc tcctcggcca gtacgagatg      4740
     ttcgacgagc tagaagccat tctcacgcag ctctggacct cccgaatcgt ccagcgcacc      4800
     tggacaccag acgtggtggt atggatcgga cgacgactag tagaaacccg cttctgccgc      4860
     ggcagcgtcg actccgccat ccagctctgc cgcgacatct gctacaacct gcgccaggtg      4920
     tggggcagct gtgacccagt cacactggat atgaccaagc tcctctctgc gctgttcact      4980
     gcctccgaga actaccagtc tgcagcgact ctgcacgagg gaatcctgta cgacctgctc      5040
     ggcgactctg gggcggtgga ccatgccaat ggtgctgata ccgcgtcgca gcacatggag      5100
     ttgttgcgcc gttcccaggc acgtctggga gctgaacaga cttctagccg gccttcggcg      5160
     catgcggagc tgttccagtc tgtggcggat cgcttcggtg tgcagtctga gcagattaag      5220
     agcgttgggg aggcgaatgg tggtgaacaa ttcggtgttt ggtcgaagcc gagacggttt      5280
     agtattgatg ttgaggatat ggaggaggag ggtcagacgc accgcaatca tctgcgtgag      5340
     tctagtggtg ctggattggg tggtaccggt agccagagac gtatctctgt gcaggctctc      5400
     taa                                                                    5403
//

If you have problems or comments...

PBIL Back to PBIL home page