(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE385

PENCW_10.PE385       Location/Qualifiers
FT   CDS_pept        complement(910677..912650)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950884"
FT                   /orf_name="Pc13g03850"
FT                   /product="Pc13g03850 protein"
FT                   /protein_id="CAP91454.1"
FT                   /db_xref="UniParc:UPI0001830783"
FT                   /db_xref="UniProtKB/TrEMBL:B6H226"
FT                   /transl_table=1
FT                   /translation="MFAKAKGILDKSSSIRNEVNQGNYNGAKDIVTKGQTTKESTSQGD
FT                   KANEPVDRNSSTRDEANRGNSNGAKETSTQGQATKESTSRGAVGGAAGGAVGGVAGGAS
FT                   GSAAGMNKDLNRENVQETGRQTSQGGIGQDNTGTSSTSHTKVEQRDMGTERREASQKQQ
FT                   HSTDAKQATGSQQYDRRGSVLAGELAANYDIRKGPITTPGTFQEKNFHTPGDKPILIQR
FT                   GGTNSKTVPRGENTDNSQFAGAGAGSGNQASLSQEKSGNPVAGGDYSKESLENEIHDYE
FT                   NISPDVFSDGTTSKDLSKKAADQDVGKYHIDRKQLDKQGSQPSQKAGTSEAAAAAAAAT
FT                   AAAGGGYGMSKGADNQTSTTRKQRKRHSVSGTNATRAEDPTSTSQKSHVASTVGEQDRV
FT                   GGQGAGASSSGNRGGYTYARAVSDHGYTPKTPTNTAYSTTSGSNQTSGLRSTTTGQTNS
FT                   ALFNNGATASNKAGIASGGVLGLHQDGSYGLSGNENSGVNQGSIVGGAGTREAGAYDTS
FT                   SNNGFNTGVTHASSGANNSVGSGMTSKRIVRQLSGSGYKVTILQEKVQAVSQKCKAQLG
FT                   LSSTQISKRSPNVDVFFDAVAAERLRWMPQDGSRLDCSLRWASRLAYAVDALRESVGVF
FT                   APAANEAASLIWGFSILLLEVS"
     atgttcgcca aggcaaaggg aatcctcgat aaaagctcat ctatccgcaa tgaagtcaac        60
     caaggcaatt acaatggtgc caaagacatc gtgaccaaag gtcaaactac caaagaatcg       120
     accagccagg gagacaaggc caatgaaccc gtcgatagaa actcatccac ccgcgatgaa       180
     gccaaccgtg gcaattccaa cggcgccaaa gaaactagca cccaaggaca agccactaaa       240
     gaatcgacca gccggggagc tgtgggagga gctgccggag gagccgtcgg tggagtcgcc       300
     ggcggagcat caggcagcgc tgctggaatg aacaaagacc ttaacaggga gaatgttcag       360
     gagaccggaa ggcagaccag ccaaggaggg attggccaag acaacactgg cacctcctct       420
     actagccata cgaaggtgga gcaaagagac atgggcaccg agaggcgaga agctagccag       480
     aaacagcaac acagcaccga cgcaaagcaa gccactggct ctcaacagta tgaccgcaga       540
     ggcagtgtgc tcgccggaga gcttgcagcc aactacgaca tccgcaaggg ccccatcacc       600
     acgccgggca ctttccagga aaagaacttc cacactccgg gtgacaagcc gattctcatt       660
     cagagaggtg gcaccaacag caaaacagta ccccgcggag aaaatacgga caattctcag       720
     tttgccggcg cgggagcagg gagcggcaac caggccagct taagccaaga aaagtctgga       780
     aaccccgtcg ccggaggaga ctatagcaag gaatctcttg aaaatgagat ccatgactat       840
     gaaaacatca gcccggacgt ctttagtgat gggaccacta gcaaagacct gtccaagaaa       900
     gctgctgatc aagatgttgg aaaataccat atcgacagaa agcagctcga caagcagggc       960
     tctcagcctt cccagaaagc agggacaagc gaagctgctg ctgctgctgc cgccgccacc      1020
     gctgccgccg gcggcggtta tggcatgagt aaaggagctg acaaccagac ctctaccacc      1080
     agaaagcaga gaaagaggca ttccgtctct gggacgaacg caaccagagc cgaagatccg      1140
     acttctacaa gccagaagag ccacgtggct tctactgtgg gagaacagga ccgtgtaggc      1200
     ggacaaggtg cgggcgcctc aagctcgggg aaccgcgggg gctatactta tgcccgcgcg      1260
     gtgtccgatc atggctacac tcctaaaaca ccgacaaaca cagcctattc taccaccagt      1320
     ggatccaacc aaaccagtgg tctacggtct acaactacgg gccagacaaa cagcgccttg      1380
     ttcaacaacg gcgccactgc atcgaacaaa gcaggtatcg ctagcggagg agttctggga      1440
     cttcaccaag acggtagcta tggtttatcc ggaaatgaaa acagcggagt caaccaagga      1500
     agcattgtcg gcggagcggg aactcgagag gctggtgcct atgatacctc aagcaataac      1560
     ggcttcaaca ctggagtcac ccacgctagc tccggtgcca ataacagcgt cgggagtggc      1620
     atgacgtcga agcgcattgt cagacagctg agtggaagtg gctacaaagt taccatcctc      1680
     caagagaagg ttcaggccgt gtcacagaag tgcaaggctc agctaggcct gtcttccact      1740
     cagatcagca agcgcagtcc taacgtggat gttttcttcg atgccgtcgc agctgaacgt      1800
     ctccgctgga tgcctcaaga tggcagcaga ctggattgca gcctcagatg ggcgtctaga      1860
     ctggcgtatg cagtcgacgc tcttcgggag tctgtcggag tgttcgcgcc tgctgccaat      1920
     gaggcggcat cgctcatctg gggattctct attctccttt tggaggtgag ttaa            1974
//

If you have problems or comments...

PBIL Back to PBIL home page