(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE388

PENCW_10.PE388       Location/Qualifiers
FT   CDS_pept        complement(916205..917551)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214140" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672466"
FT                   /orf_name="Pc13g03880"
FT                   /product="Pc13g03880 protein"
FT                   /protein_id="CAP91457.1"
FT                   /db_xref="InterPro:IPR018612"
FT                   /db_xref="UniParc:UPI0001830786"
FT                   /db_xref="UniProtKB/TrEMBL:B6H229"
FT                   /transl_table=1
FT                   /translation="MPANLPYGLNLPNKSLAATKPGNALGQKRKNIFDDDSDEDQQTGD
FT                   GAIEISTIGGLEEPATNKKPSPSAGPPPKRKIQFGSGPKPTAKPLGKNSLFADDEDEDE
FT                   EREKDQQGAMNLGLNQAKSKKPTAPAQIYTNLASMHSSNVQAKAAEELDPLVYSYDEVY
FT                   DSLHAKPAKVSVETKSDTPKYMQNLLQSAEIRKRDQLRAKDRQLAREREAEGDEFEDKE
FT                   KFVTSAYKAQQAELRKAEEEEARREKEEEERRKKSGGSGMIGFYRDVLSRGEARHEEVI
FT                   KAAEETARRVKAGEIIEETEDKEDKSDAQKAEDLNAHGARVVVNDEGQVVDKRQLLSAG
FT                   LNVAPKPKAPASAAKAGVSRPTVGRPGAGAGYQGGRAAQRARQTDMVASQYEERARQEE
FT                   EAEAAKQREIAEKSRSRKTEKDVSSAKERYLARKREREEAAAKEKSKGA"
     atgccagcaa acctccccta cggattaaac cttcctaaca agagtcttgc ggcgacaaaa        60
     ccggggaatg ctctcggaca gaaaagaaag aacattttcg acgacgactc cgatgaagac       120
     cagcaaactg gcgacggtgc aattgaaatc tcaactattg gagggctaga ggagccagct       180
     acaaacaaga aaccttcgcc aagcgcaggg ccaccgccga aacgcaaaat tcaattcggg       240
     agcggtccca aaccaacagc caaaccgctc ggcaagaact cgctatttgc agacgatgag       300
     gatgaagacg aagaaagaga aaaagaccaa caaggcgcaa tgaatcttgg gttgaaccag       360
     gcgaagtcga agaagccaac cgcccctgcc cagatataca ccaatctcgc gtcaatgcat       420
     agcagcaatg tgcaagcaaa ggcagctgaa gaactcgacc cattggtata ttcatacgat       480
     gaagtatacg acagcttgca cgccaaaccc gccaaggtct cagtggaaac caagagtgac       540
     acacccaagt acatgcagaa cttgctacag agtgcggaga tccggaaacg ggatcaactg       600
     cgggctaagg atcgccagtt agccagggag cgtgaagctg aaggtgacga gtttgaagac       660
     aaggaaaaat ttgtcacatc tgcctacaag gcccagcaag cggaactgcg aaaggcagaa       720
     gaagaggaag cacgccgtga aaaggaagag gaagaacggc gcaaaaagag cggcggctcc       780
     ggcatgattg gattctaccg ggacgttctg tcacgaggag aagcacggca cgaggaggtc       840
     atcaaggctg cggaagaaac tgcccgccgc gtcaaagcag gcgagatcat cgaggagacg       900
     gaggataaag aggataagtc ggatgcccag aaggcggagg atctcaatgc tcatggagct       960
     cgggttgttg tgaatgatga aggccaagtt gtcgacaagc gccagctgtt atctgcagga      1020
     ctgaatgtgg caccgaaacc gaaagcccca gcatctgctg ccaaagcagg agtttcgcgg      1080
     cctaccgtcg gacgaccagg cgccggtgct ggttaccagg gcggccgtgc tgctcaacga      1140
     gctcgacaga ccgacatggt cgcaagccaa tacgaggagc gtgcgcgaca agaagaggag      1200
     gctgaggctg caaagcaaag ggagatcgct gaaaagagcc gcagtcgcaa gacggagaaa      1260
     gatgtgtcca gcgccaaaga gcggtatctg gcaagaaaga gagaacgaga agaggctgct      1320
     gccaaggaga aatcaaaggg ggcctag                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page