(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE389

PENCW_10.PE389       Location/Qualifiers
FT   CDS_pept        join(918117..918394,918567..918933)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214139" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950885"
FT                   /orf_name="Pc13g03890"
FT                   /product="Pc13g03890 protein"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91458.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI0001830787"
FT                   /db_xref="UniProtKB/TrEMBL:B6H230"
FT                   /transl_table=1
FT                   /translation="MAAASKAAIPSSSAVLGSISTLNNPSLLKMSYYFTILSPTDTPLF
FT                   NIAFGTSKGGGDGIARFRFPETAQYMNQFIIHSSLDILEEAQWTNGGMYLKHIDTYPPA
FT                   AAYITAFLTPSGARFLLLHQPPNLPSSTSSSSGLGSSSLLGTAGSTTRASSSSIAANPT
FT                   SPQTEEAVRQFMNEVYENYVKTAMSPFYKQGMEIKSPVFRTRVTAAGKKWL"
     atggcggccg ctagtaaagc cgcaatcccc agctcctcgg ccgtccttgg gtccatctcc        60
     accctgaata atcccagtct gcttaaaatg tcctattact ttaccatcct gtcacccacc       120
     gacacgcctt tgttcaacat cgcctttggt acatcaaagg ggggtggtga tggcattgcc       180
     cgcttccgct tcccggagac ggcgcagtac atgaaccagt tcatcatcca ctcaagtctt       240
     gacatattgg aagaagcgca atggaccaat ggcggaatgt acctgaagca tatcgataca       300
     tacccaccgg cagcagccta catcacggcc ttcctcactc caagtggcgc gcgcttcctc       360
     ctcctccacc aacccccaaa cctcccctct tcaaccagca gcagcagcgg cctcggttcc       420
     tcctcactgc taggcacagc aggatccacc acacgtgcct cgtccagctc tatcgccgca       480
     aacccgacat ccccgcagac cgaagaggcc gtgcgccagt ttatgaacga ggtatacgag       540
     aactatgtca agacggcgat gagtccattc tataagcagg gaatggagat caagagtcct       600
     gttttcagga cgcgggttac tgctgcaggg aaaaaatggc tgtag                       645
//

If you have problems or comments...

PBIL Back to PBIL home page