(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE390

PENCW_10.PE390       Location/Qualifiers
FT   CDS_pept        join(complement(920615..920724),complement(920126..920550),
FT                   complement(919937..920068),complement(919381..919883))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000078668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950886"
FT                   /orf_name="Pc13g03900"
FT                   /product="Pc13g03900 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91459.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR004330"
FT                   /db_xref="UniParc:UPI0001830788"
FT                   /db_xref="UniProtKB/TrEMBL:B6H277"
FT                   /transl_table=1
FT                   /translation="MADSTDLNLDDAPSDLQDIPELAMQLVPPPEGTYPDKATLLAAVQ
FT                   DHGKEHGYNVVVKSSSTPTEKKPGRTAKVWLRCDRGGHYRPRNGLTEETRKRRRTSRLM
FT                   DCPFMLVAAGSPGIWTLTVLNAAHNHGPVIEKPRQVPHHKVRKGQLPAVPYDWPHDASF
FT                   TPYTTALVIIDMQKDFCLPEGYMGYQGYDISAAQALIPRLQRLLHAFRSGGFPVYHTRE
FT                   GHRPDLSTLSSREAYRSRNNASGLGIGSPGPMGRLLIRGELGHDTVDELYPLPGEPVID
FT                   KPGRGAFAHTDFELLLRNKGVKNLVIAGVTTDVCVSTTMREANDRGFDCVVLDDGTAAA
FT                   EPSLHLGTMQSVKMEGGIFGTVAKLEDVIHAVDNFKTVTMKKLAPQMTV"
     atggcagact cgaccgatct caaccttgac gatgcgccca gcgaccttca agacattccg        60
     gagctggcaa tgcaattggt tccccctccg gagggaacat accctgacaa agcaactctt       120
     ctcgccgcgg tccaggacca tggcaaggaa catggctaca atgtggtcgt taagtcgtca       180
     agcacgccca cagagaagaa acccggccgc accgccaagg tctggctgcg ttgtgatcgt       240
     ggcggccact atcggccacg gaacggtctg actgaggaaa cgcgcaagcg ccgcagaacc       300
     tcgcggttga tggattgtcc tttcatgcta gtcgcagcag gctctccagg tatctggacc       360
     ctgacggtgc taaatgcggc acacaatcat ggtcctgtta tcgagaagcc gcgacaggtg       420
     cctcaccaca aggtccgcaa gggccagctg ccagccgtcc catacgattg gccccatgac       480
     gcttcgttca ccccatacac cactgcactt gtgataattg atatgcaaaa ggacttctgt       540
     ctgcccgaag ggtacatggg atatcaggga tatgatattt ctgccgcaca ggctttgatt       600
     ccccgcctgc aaagattgct tcatgctttc cgctctgggg gtttcccggt ctatcatact       660
     cgcgagggac accgacccga tctatccact ctctcgagtc gtgaggcata ccggtcccgt       720
     aacaacgcat ccggcttggg tattggctcc cccggcccca tgggccgcct gcttatccgt       780
     ggcgaactgg gccatgacac tgttgacgaa ttgtatcctc tccccggtga gcctgtcatc       840
     gacaagcccg gccgaggtgc ctttgcacac accgactttg agcttctcct tcgcaacaaa       900
     ggggtgaaaa acctcgtcat cgcaggtgtg accaccgacg tctgcgtctc aacgaccatg       960
     cgcgaagcta atgaccgtgg cttcgactgt gtcgttctgg atgacggtac tgcggctgcg      1020
     gagccgtcgc tgcatctggg caccatgcaa tccgtcaaaa tggaaggcgg aatcttcggc      1080
     actgttgcca agttggaaga tgtcatccac gctgtcgata atttcaaaac cgtcaccatg      1140
     aagaagctgg ctcctcagat gaccgtctaa                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page