(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE391

PENCW_10.PE391       Location/Qualifiers
FT   CDS_pept        join(921660..921896,921953..923509)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214116" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950887"
FT                   /orf_name="Pc13g03910"
FT                   /product="Pc13g03910 protein"
FT                   /protein_id="CAP91460.1"
FT                   /db_xref="InterPro:IPR006964"
FT                   /db_xref="UniParc:UPI0001830848"
FT                   /db_xref="UniProtKB/TrEMBL:B6H275"
FT                   /transl_table=1
FT                   /translation="MPAVDESTSERKHTSSSYRDELAHYKAQYELLEAELADFQSSSRE
FT                   LETEMEKDIEASEKRERQLKEKLDTMRYEVDEWKSKYKQSKTEGNSVQNNLQKEITTLR
FT                   EANRTLQLKLRDIEVANDDYERQARNTTSSLEDMESKYNIGIERQVLLEEEIRSGEQER
FT                   EQLRIDNQRLRDELSDLKIETEIIQEKLRNTEGHGMRRRKPTPLYHRSPATPQSLEIFD
FT                   RSPGTATSSPVFATPPAKSSLASSTATPPSPPISESSVNMRKSINAHSNSTPTFPRQRA
FT                   AGADPVNSRTLHARTQPRTTHSRTPSLAYSNGAYSTGNGNSSGNGRSTPSMSISSRNSL
FT                   TRMNTSRPPGLPKSGSLFQIRGLIGKMQKLEERVQSAKSRLPAPSDTSSRGSPRSGSVI
FT                   SDTPIVPSSITVRRDSRKRLSNSSLGSSARDSESTPSYPPQGRQSFGRTGESRPSSRTS
FT                   YSSRSSFSQSVHSGVPANARPESRSSRPGAKTPLGHYSTNPMTEGRRPRSSLSNHAGQL
FT                   PNIAGMSLIDEDQDITTPTTSQISQEIQRPSVTTTPTPIVKKRTISGIPAPRSFKTSIG
FT                   PGTMPPPPNRKTQVSDLGETF"
     atgccggccg tcgatgagtc aacttccgaa cggaagcata cgagcagctc ttacagagat        60
     gaactggctc attacaaagc ccagtatgag ctgcttgagg cggagcttgc ggacttccag       120
     tcctccagcc gggagctgga gactgagatg gagaaggaca ttgaagcttc ggagaagcgg       180
     gagaggcagc tgaaggaaaa gctcgatacg atgcgatatg aagtcgacga gtggaagagc       240
     aaatacaagc agtcgaaaac cgaaggcaac tctgtgcaga acaacctgca gaaagaaatt       300
     accacactgc gggaagcgaa ccgcactttg cagctcaagc ttcgagatat tgaagttgcc       360
     aacgatgact acgagcgcca agcccggaac accacctcgt ccctggagga catggagtcc       420
     aaatacaaca ttggcatcga gcgccaggtc ttgctagagg aggagataag aagtggggag       480
     caggaacggg agcagctgcg cattgacaac cagcgcctcc gggatgagct gtcggatctg       540
     aagattgaga ccgagatcat ccaggagaag cttcgaaata ccgaagggca tgggatgcgc       600
     cggcgcaagc cgactccttt gtaccatcgc agccccgcga ctccacagag tctggagatc       660
     tttgaccgtt cgcctggcac cgctacatct tcaccagtat ttgccacgcc ccccgctaaa       720
     tcatcccttg cgtcgtctac cgctactcca ccttcacccc cgatctcgga gtcgtctgtg       780
     aacatgcgca agtcgatcaa cgctcactca aactctacgc ctacattccc tcgacagaga       840
     gccgctggcg cggatccggt gaactctaga acccttcacg cacggactca accgcgcacc       900
     actcattcac gaaccccatc tctcgcttac agcaatggcg catatagcac cggcaatggc       960
     aacagcagcg gaaatggtcg gtcaactccc tctatgtcga tctcgtctcg caacagtttg      1020
     acgagaatga acacctcgcg gccaccaggg cttcccaagt ctggctcact gttccagatc      1080
     cgtggcctga ttggtaagat gcagaagctc gaagagcgcg ttcaatcagc caaatcacga      1140
     cttcccgccc catctgacac ctcttctcgc ggatcccctc gctcagggtc tgtgatcagc      1200
     gacaccccca ttgtgccctc gtcgatcact gttcgcaggg attctcgcaa gcggctgagt      1260
     aatagtagcc ttggttcctc ggcacgggat agtgaaagta ctccatctta tcccccacag      1320
     ggtcgccagt catttggccg gacaggcgag agccgcccga gcagccgaac tagttactct      1380
     agccgcagct ccttcagcca gagtgtgcac tcgggtgtcc ccgcaaatgc gcggccggaa      1440
     agccgttcga gtcgtccggg ggccaaaacg ccactgggtc actactcgac gaaccctatg      1500
     acagagggac ggcgacctcg ctcatctctc agcaatcatg ccggccaact ccctaacatt      1560
     gctggcatgt cactcatcga cgaggaccaa gacattacaa cgccaacaac ctcccaaatc      1620
     tcccaggaaa tccaacgccc atctgtgact actactccca cgcccatagt gaagaagcga      1680
     accatcagtg gcatcccggc tccccggagc ttcaagacca gcatcggacc tggtaccatg      1740
     ccgccgccgc caaacaggaa gacccaagtc agcgacctgg gagagacctt ttaa            1794
//

If you have problems or comments...

PBIL Back to PBIL home page