(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE392

PENCW_10.PE392       Location/Qualifiers
FT   CDS_pept        join(925189..925335,925416..925681,925752..932160)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214115" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978328"
FT                   /orf_name="Pc13g03920"
FT                   /product="Pc13g03920 protein"
FT                   /function="ATP binding"
FT                   /function="acetyl-CoA carboxylase activity"
FT                   /function="biotin binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /protein_id="CAP91461.1"
FT                   /db_xref="GO:0003989"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0009374"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013537"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniParc:UPI0001830849"
FT                   /db_xref="UniProtKB/TrEMBL:B6H276"
FT                   /transl_table=1
FT                   /translation="MGSTMGNSSAVTKHDIPSHFIGGNALESAPPSAVKDFVAAHDGHS
FT                   VITSVLIANNGIAAVKEIRSVRKWAYETFGNERAIQFTVMATPEDLTANADYIRMADQY
FT                   VEVPGGTNNNNYANVELIVDVAERMDVHAVWAGWGHASENPRLPESLAASPKKIIFIGP
FT                   PASAMRSLGDKISSTIVAQHAGVPCIPWSGTGVDAVKLDENGIVTVEDEVYNQGCTFSP
FT                   EEGLAKAKEIGFPVMVKASEGGGGKGIRKVENEEDFPALYNAAANEIPGSPIFIMKLAG
FT                   NARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKQPTFQAMERAAVSLG
FT                   KLVGYVSAGTVEYLYSHSDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPL
FT                   HRIRDIRLLYGVDPNTSADIDFDFSKEESFQTQRRPQPKGHTTACRITSEDPGEGFKPS
FT                   SGTMHELNFRSSSNVWGYFSVGTAGGIHSFSDSQFGHIFAYGENRSASRKHMVVALKEL
FT                   SIRGDFRTTVEYLIKLLETPAFEDNTITTGWLDQLISNKLTAERPDQIVAIICGAVTKA
FT                   HLASEAGIEEYRNGLGKGQVPSKEILKTVFPVDFIYEGERYKFTATRASLDSYHLFING
FT                   SKCSVGVRALADGGLLVLLSGRSHNVYWKEEAAATRLSVDGKTCLLEQENDPTQLRSPS
FT                   PGKLVKFTVENGEHIRSGQSYAEVEVMKMYMPLIAKEDGIVQLIKQPGATLEAGDILGI
FT                   LALDDPSRVKHAQPFTGQLPELGSPTVLGNKPSQRFFLLHSILENILRGFDNQVIMGTT
FT                   LKDLVEVLRNPDLPYGEWNAQSSALHSRIPQKLDAQLQNVVDRAKARKAEFPAKQLQKA
FT                   IVRFIEEHIGPADAELLKTTLLPLVQVINKYMDGLKSNEYNVFIGLLEQYYDVEKLFST
FT                   HNLRDEDVILKLREENKDDITGIVHTVLSHSRIGSKNNLVLAILDMYRPNQPHLENVGT
FT                   YFKPILKKLTELESRSSAKVTLKAREVLIQCAMPSLDERLSQMEHILRSSVVESRYGET
FT                   GWEHREPSLDVLKEVVDSKYTVFDVLPRFFVHADPWVTLASLEVYVRRAYRAYTLKSID
FT                   YNASTEQPFLSWDFTLGKLGQREFGVLNSTQPSAPGTPIAEVNPFKRINSIGDMSLFVS
FT                   DAASDPVRKGVIIPVQYLEDAEEILCKALEVFPVGGSNAKCPSEQGLIATLEGKRRPAP
FT                   KPVSDSELTGVCNIAIRDIEDMEDADLVAQMKQLLADNKDELLARRIRRVTFICGKQGV
FT                   YPGYFTFRGPNYEEDLSIRHSEPALAFQLELGRLSKFNIKPVFTENRNIHVYEAIGKGP
FT                   ENDKAIDKRYFVRAVVRPGRLRDDIPTAEYLISEADRLMNDILDALEIIGNNNSDLNHI
FT                   FINFSPVFNLQPVDVEQALAGFLDRFGRRLWRLRVTGAEIRILCTDPATGMPYPLRVII
FT                   SNTYGFIINVELYIERKSEKGEWIFQSIGGTAKLGSMHLRPVSTPYPTKEWLQPKRYKA
FT                   HLMGTQYVYDFPELFRQAFQNSWTKIAEKIPSLYEKRPPVGECIDYSELVLDDTDNLVE
FT                   VSREPGTNTHGMVGWIITARTPEYPRGRRFIIVANDITFQIGSFGPQEDRFFHKCTELA
FT                   RKLGIPRIYLSANSGARIGVADELIPFFSVAWNNPEKPEAGFKYLYLTPEVKKRFDASK
FT                   KKEVITELVNDDGEERHKITTVIGAKDGLGVECLKGSGLIAGATSKAYEDIFTITLVTC
FT                   RSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKLLGREVYTSNLQLGGTQIMYKNGVS
FT                   HMTANDDFAGVEKIVEWMSFVPDKKNAPIPIRPWSDTWDRDVAYFPPPKQTYDVRWLIG
FT                   GKEDVDGFLPGLFDKGSFEEALGGWARTVVVGRARLGGIPMGVIAVETRSVENVTPADP
FT                   ANPDSMEMIATEAGGVWYPNSAYKTAQALRDFNNGEQLPVMILANWRGFSGGQRDMYNE
FT                   VLKYGSYIVDALVKYEQPIFVYIPPHGELRGGSWVVVDPTINPDQMEMYADEDSRGGVL
FT                   EPEGMVNIKYRREKQLDTMARLDATYGELRRSLADTSLTNEQLSEVKAKMAAREEQLLP
FT                   VYMQIALQFADLHDRAGRMQAKDTIRKPLQWVNSRRFFYWRLRRRLSEETIVKRMVAAS
FT                   APAASGVGATGESLRTAHLRTLHAWTGLLDEELEHDDHKVATWYEENKKVVQSKVESLR
FT                   TDGVASEVAQLLIGNKEGGLRGVQQVLSMLPVEERENVLKYLGSA"
     atgggtagca caatgggcaa cagctcggct gtcaccaaac atgacatccc ttcacatttc        60
     atcggtggca atgccctcga atcagcacct cctagcgctg tgaaggactt cgtggccgcc       120
     cacgatggtc actccgtcat cacatcggtg cttattgcca acaacggtat cgccgctgtc       180
     aaagagattc gctcggtgcg gaaatgggct tacgagacct tcggcaacga gcgggctatc       240
     caattcactg tgatggccac gcccgaagat ttgaccgcca acgccgacta tattcgcatg       300
     gccgaccaat acgtcgaggt tcccggtgga accaataata ataattatgc caacgtcgag       360
     ttgattgtcg atgttgcgga gcggatggat gtgcacgccg tgtgggcagg atggggccac       420
     gcctccgaaa accctcggtt acccgaatct cttgctgcgt cgccgaaaaa gatcatcttc       480
     attggacctc cagcttcggc catgcgctcg cttggtgaca agatttcctc tactattgtt       540
     gcacagcacg ccggtgtgcc ttgtattccc tggtccggaa ccggtgtcga cgccgtgaag       600
     ctcgatgaga acggtatcgt gacagtcgag gacgaggtct ataaccaggg ttgcaccttc       660
     tcgccggaag agggtttggc gaaggctaag gagatcggtt tccctgttat ggtcaaggcc       720
     tctgaaggtg gcggtggtaa gggtatccga aaggtcgaga acgaggaaga tttcccggcc       780
     ttgtacaatg ccgccgccaa cgaaattccg ggatcgccta tcttcatcat gaagctggct       840
     ggcaacgctc gccatctcga ggtgcagttg ctggctgatc agtacggcaa caacatttcc       900
     cttttcggtc gtgattgttc agttcagcgt cgtcaccaga agattatcga ggaggcccct       960
     gtgaccattg cgaaacagcc caccttccag gcaatggagc gcgctgccgt gagccttgga      1020
     aagttggtcg gatacgtttc ggctggtacc gtcgagtacc tctactcgca ctccgatgac      1080
     aagttctact tcctcgagtt gaaccctcgt ttgcaggtcg agcatcccac cactgagatg      1140
     gtgtcgggag tcaacttgcc cgccgcgcag ctccagattg ctatgggtat ccctctgcac      1200
     cgcattcgcg acattcgcct cctttacggt gtcgacccca acacctccgc tgacattgac      1260
     ttcgacttct ccaaggagga gagcttccag acccaacgtc gtcctcagcc caagggtcac      1320
     accactgcct gccgtatcac ctccgaagat cctggcgagg gattcaagcc ttccagcggt      1380
     accatgcacg agctgaactt ccgcagttcg tcaaacgttt ggggttactt ctctgtcggt      1440
     actgctggtg gtatccacag cttctccgac agtcaattcg gtcacatttt tgcatacggc      1500
     gagaaccgat ccgcttcgcg caagcacatg gtcgttgctt tgaaggagtt gagcattcgt      1560
     ggtgatttcc gaaccactgt cgaatacctg atcaagctcc tcgaaacccc cgctttcgag      1620
     gacaacacca tcaccactgg gtggctcgac cagcttatct ctaacaagct gactgctgag      1680
     cgccctgatc agatcgtcgc tatcatttgt ggtgccgtca ccaaggctca cctcgctagc      1740
     gaggctggta tcgaggagta ccgcaatggt ctaggaaagg gtcaggtccc gtccaaggag      1800
     atcctgaaga ctgttttccc tgttgacttc atctacgaag gcgagcgtta caagttcacc      1860
     gccactcgtg ccagcttgga cagctaccac ctcttcatca acggctccaa gtgctcagtc      1920
     ggtgttcgcg ccctggctga tggtggcttg ctggttctcc tcagcggccg cagtcacaac      1980
     gtctactgga aggaggaggc tgctgccacc cgtctcagcg ttgacggcaa gacctgcctc      2040
     ttagagcagg agaacgatcc tacgcagctc cgttctcctt cccccggtaa gcttgtcaag      2100
     ttcaccgtcg agaatggaga gcacatccga tctggacagt cttacgccga ggttgaggtt      2160
     atgaagatgt acatgcccct catcgcaaag gaggatggta tcgtgcagct cattaagcag      2220
     cccggtgcca ctctggaggc tggtgatatc ctcggtatcc tcgctctgga tgacccctcc      2280
     cgcgtcaagc acgcccagcc cttcactggt cagctgcccg agcttggatc gcctaccgtc      2340
     cttggtaata agccctccca gcgcttcttc ctgctccaca gcattctgga gaacattctt      2400
     cgtggtttcg acaaccaggt tatcatgggt accactttga aggaccttgt tgaggtgctg      2460
     cgcaaccctg accttcccta cggagagtgg aatgcgcagt cttctgcgct gcactctcgc      2520
     attcctcaga agctggatgc gcagctccag aacgtggttg accgtgccaa ggcccgcaag      2580
     gccgagttcc ctgccaagca gctccagaag gccatcgttc gcttcatcga ggagcacatc      2640
     ggccctgccg atgctgagct gctcaagacc accctcttgc ccctggttca ggtcatcaac      2700
     aagtacatgg acggtttgaa gtccaacgag tataatgttt tcattggctt gctggagcag      2760
     tactacgatg ttgagaagct gttttccacc cataacctcc gcgacgagga tgtcattctc      2820
     aagctccgtg aggagaacaa ggacgacatt accggcattg tccacactgt tctctcccac      2880
     agccgcatcg gttcgaagaa caacctggtc ctggctattt tggacatgta ccgccccaac      2940
     cagccccacc tggagaatgt cggcacatac ttcaagccta tcctcaagaa gttgaccgag      3000
     ctcgagtctc gttcttccgc caaggtcact ctcaaggccc gcgaggttct tattcagtgc      3060
     gctatgccat ctctggacga gcgcctgtcg cagatggagc acattctgcg gtcttccgtt      3120
     gttgagtctc gctacggcga gaccggatgg gagcaccgtg agccttcctt ggatgtcttg      3180
     aaggaggttg ttgactcgaa gtacactgtt ttcgatgttc ttcctcggtt cttcgtccac      3240
     gctgacccct gggtcaccct cgcctccctg gaagtttacg ttcgtcgtgc ctaccgtgca      3300
     tacaccctta agagcatcga ctacaacgcc tccactgagc agcctttcct gtcttgggac      3360
     ttcacccttg gcaagcttgg ccagcgcgag ttcggtgttc ttaactccac ccagccctcc      3420
     gccccgggca ctcccattgc ggaggtcaac cccttcaagc ggatcaactc catcggcgac      3480
     atgtccctct ttgtgagtga cgctgccagt gaccccgttc gcaaaggtgt tattatcccc      3540
     gtgcaatacc tggaggatgc tgaggagatc ctctgcaagg ctctcgaggt cttccctgtc      3600
     ggcggctcga acgccaagtg ccccagtgag cagggcctca ttgctaccct cgaaggcaag      3660
     cgtcgtcccg cccctaagcc cgtgagtgac agcgagctca ccggagtctg caacattgcc      3720
     attcgcgata tcgaagacat ggaagatgca gatcttgttg cgcagatgaa gcagctgctc      3780
     gccgacaaca aggatgagct cctcgcccgc cgtattcgcc gtgttacctt catctgcggc      3840
     aagcaaggtg tctaccccgg ctacttcacc ttccgtggtc ccaactacga ggaggatctg      3900
     agtatccgcc acagcgagcc agctcttgcc ttccagcttg aactcggccg tctgtccaag      3960
     ttcaacatca agcccgtctt caccgagaac cgtaacatcc acgtctacga ggctattggc      4020
     aagggccctg agaatgataa ggctattgac aagcgctact tcgtccgtgc tgtggtccgt      4080
     cccggccgtc tacgtgacga tatccccacc gctgagtact tgatctcgga ggccgaccgc      4140
     ctcatgaatg acatcttgga tgccctggag atcattggca acaacaactc cgacctgaac      4200
     cacatcttca tcaacttctc tcccgtcttc aacctccagc ccgtcgatgt cgagcaagcc      4260
     ctggccggtt tcctcgatcg cttcggccgc cgtctgtggc gcctccgtgt caccggcgca      4320
     gagatccgca tcctttgcac cgaccccgct accggaatgc cttaccccct gcgtgtgatt      4380
     atcagcaaca cctacggttt catcatcaac gtcgagctgt acattgagcg caagtccgag      4440
     aagggcgagt ggatcttcca gagcattggt ggtaccgcca agctgggctc tatgcatttg      4500
     cgccctgtct ccacccccta ccctaccaag gagtggctgc agcccaagcg ctacaaggct      4560
     cacttgatgg gaactcagta cgtgtacgat ttccccgagc ttttccgcca ggcattccaa      4620
     aacagctgga ccaagattgc cgagaagatt ccttccttgt acgagaagcg ccccccagtt      4680
     ggagagtgca ttgactacag cgagctggtc ttggatgaca ccgacaacct tgttgaagtg      4740
     tctcgcgagc ccggtaccaa cactcacggt atggttggtt ggatcatcac tgcccgtact      4800
     cccgagtacc cccgcggcag acgtttcatc attgtcgcca acgacatcac cttccagatt      4860
     ggttccttcg gtcctcagga agacaggttc ttccacaagt gcactgagct tgcccgcaag      4920
     ctgggtattc cccgtatcta cctgtctgct aactccggtg cccgcatcgg tgttgcggat      4980
     gagctgattc ccttcttctc ggttgcctgg aacaacccgg agaagcccga ggccggcttc      5040
     aagtaccttt acctcactcc cgaggtcaag aagcgcttcg atgccagcaa gaagaaggag      5100
     gtcatcaccg agctcgtcaa tgacgacggt gaggagcgcc acaagattac caccgtcatc      5160
     ggtgccaagg acggtcttgg tgttgagtgt ctgaagggtt ccggtctcat tgccggtgcc      5220
     acctccaagg cttacgagga catcttcacc atcactctcg ttacctgccg ctctgtcggt      5280
     atcggtgctt accttgtgcg tctcggtcag cgtgccatcc aggttgaggg ccagcccatc      5340
     atcctcactg gtgcccctgc catcaacaag ctgcttggtc gcgaggttta cacctccaac      5400
     cttcagcttg gtggcaccca gatcatgtac aagaacggtg tttctcacat gactgccaac      5460
     gacgacttcg cgggtgttga gaagattgtc gagtggatgt ctttcgtccc tgacaagaag      5520
     aatgctccta tcccgattcg cccctggtcg gacacctggg accgtgacgt tgcctacttc      5580
     ccacctccca agcagactta tgatgtcaga tggctcatcg gtggtaagga ggacgttgac      5640
     ggcttccttc ctggtctttt cgacaagggt tccttcgagg aggcccttgg tggctgggct      5700
     cgcaccgtcg ttgtcggtcg tgcccgtctt ggtggtatcc ccatgggtgt gatcgccgtc      5760
     gagacccgct cggtggagaa tgtcactcct gccgatcctg ccaatcccga ctctatggag      5820
     atgatcgcca ccgaggctgg tggtgtctgg taccccaact cggcctacaa gaccgcccag      5880
     gctctgcgcg acttcaacaa cggcgagcag ctgcccgtca tgatcctggc taactggaga      5940
     ggattctccg gtggccagcg tgacatgtac aacgaggtcc tcaagtacgg ttcgtacatt      6000
     gtcgacgctc tcgtcaagta cgagcagccc atcttcgtgt acattcctcc tcacggcgag      6060
     ctccgcggtg gatcttgggt cgtcgttgac cccaccatca accccgacca gatggagatg      6120
     tacgccgacg aagactcccg cggtggtgtc ctcgagcccg agggtatggt gaacatcaag      6180
     taccgccgcg agaagcagct ggacactatg gcccgtctgg acgcgaccta cggcgaactc      6240
     cgccgctccc tggccgacac ctcccttacc aacgagcagc tcagcgaggt caaggcgaag      6300
     atggccgccc gcgaggagca gctcctgccc gtgtacatgc agattgcgct gcaattcgcc      6360
     gacctgcacg accgcgccgg ccgcatgcaa gccaaggaca ctatccgcaa gcctctgcag      6420
     tgggtcaact cccgtcgctt cttctactgg cgtctgcgtc gccgtctcag tgaagagacc      6480
     atcgtcaagc gcatggtcgc cgcctcggca cccgcagcct ctggcgtcgg cgctaccggc      6540
     gaatccctgc gcactgccca tctccgcacc ctgcacgcct ggactggact gctggatgag      6600
     gagctcgagc acgatgacca caaggtcgct acttggtacg aggagaacaa gaaggttgtg      6660
     cagagcaagg ttgagtcgct gcgcactgat ggcgttgcgt ctgaggttgc tcagctgctt      6720
     attggcaaca aggagggtgg tctgcgcggt gtgcagcagg tgctttccat gttgcctgtt      6780
     gaggaacgtg aaaatgtgct gaagtacctt ggttctgctt ag                         6822
//

If you have problems or comments...

PBIL Back to PBIL home page