(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE393

PENCW_10.PE393       Location/Qualifiers
FT   CDS_pept        join(934229..934502,934551..935468,935527..936083)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210999" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950888"
FT                   /orf_name="Pc13g03930"
FT                   /product="Pc13g03930 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91462.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183084A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H278"
FT                   /transl_table=1
FT                   /translation="MIVVYKKIKKRNERKRLNSASNTDNAIELNPVNPRLDRKKKKTVS
FT                   PEQVAEKRRRNVYRWKIILGLFSPYCLQALDTTIIASALPFIAEDFNQIKQLNWIISVF
FT                   NLTSAAFLFFWAQLTDLFGRHIILQSAIFIMMIGSAVCTGAPTSSFSVLLLGRALQGIG
FT                   AAGVNISIRTILADRVSLAEYAVNWTVFALVSGIGFSIGPVIGGYLTQASWRWCFAINL
FT                   PIAVVAMVIVVFVLRTELQGPQSIPEFEERGTSTRSGRFLARISTIDYGGQMLFLWGFG
FT                   LLILALTWAGGTYSWNSVAVLAPMVIGAVLAGAWVVYERCMVPGALMARVLPRQKAMVP
FT                   WELLRQRDIGLLFLINFSTGIAMFAVMYFMDIYFTLVEGRSSSDAGIALLFFLPGLAAG
FT                   LYMAMFSSNVWPRQTFPALFLGSITSAVGMTVLAWGVQAGRTNIIYGMMALVGHGVGMR
FT                   MNPASMHGLAYFPAMTAQITCLASFAVPFGGLLGLTIMSTVFTNKSGVGQADAKDGVMW
FT                   AFIAMMPVMWLSVLITTFLGNVWVLKEGGHEVVNCSYLWGLIFGRDIVRERRDRGEEAG
FT                   DVELTV"
     atgattgtgg tatacaagaa aatcaagaag cgcaatgagc ggaaacgcct aaattctgcg        60
     tcaaatacag acaatgcaat cgaattaaac ccagttaatc cacggcttga cagaaagaaa       120
     aagaaaaccg tatcccccga acaagtggcc gagaagagac gaagaaatgt ctaccgctgg       180
     aagatcatcc tgggcctatt cagtccatac tgcctacaag ccctagatac aacaatcata       240
     gcctcagctc taccattcat cgcagaggac ttcaaccaaa tcaaacaact aaactggata       300
     atctccgtct tcaacctcac atcagccgcc ttcctcttct tctgggccca gttaaccgac       360
     ctcttcggcc gccacatcat cctccaatcc gcaatcttca taatgatgat cggctccgca       420
     gtctgcaccg gcgccccaac atcatcattc agcgtcctcc tcctcggccg cgctctacaa       480
     ggcatcggcg ccgcaggcgt caacatctcc atccgcacca tcctcgccga ccgcgtctcc       540
     ctcgccgagt acgcagtcaa ctggacggtc ttcgccctcg tctccggcat cggattcagc       600
     atcgggcccg tgatcggcgg gtatctgacg caggcgtcgt ggcgctggtg tttcgcgatc       660
     aatctaccca tcgcagttgt agctatggtt attgtcgtgt ttgttctgag gacggagtta       720
     cagggtccgc agtctattcc tgaattcgag gagagaggta cctcgactcg gtctggtcgg       780
     ttccttgcca gaatatcgac tatcgactac ggcggtcaga tgctcttcct ttggggattt       840
     ggtctgctta ttctcgcttt gacgtgggcg ggtggtacgt actcgtggaa ctccgtcgcc       900
     gtcctggcgc ccatggttat cggtgctgtt ctggccggtg cttgggttgt ctatgagcgc       960
     tgtatggtgc ctggcgcatt aatggcacgg gtcctcccgc gtcaaaaggc tatggtgccg      1020
     tgggaattac tgagacagcg cgatatcggc ttgctgtttc tgattaattt ctcgaccggg      1080
     atagccatgt ttgctgttat gtatttcatg gatatatact ttacgctggt ggaagggagg      1140
     agttctagcg acgccggtat cgctctgcta tttttccttc ctggtctcgc tgctggactt      1200
     tacatggcga tgttctcatc gaacgtctgg ccccggcaaa ccttcccagc cctctttctg      1260
     ggcagtataa cgtctgctgt agggatgaca gtgcttgcgt ggggagtgca agcaggcaga      1320
     acaaatatca tctacggcat gatggcgtta gttggacacg gcgtggggat gagaatgaac      1380
     ccggcttcta tgcatggatt ggcgtatttc cctgcgatga cggcgcagat tacgtgtctt      1440
     gcttcgtttg cggttccgtt tggggggctg ttgggattga ctatcatgtc gacggtgttt      1500
     acgaataaga gtggggttgg gcaggcggat gctaaagatg gtgtgatgtg ggcttttatt      1560
     gctatgatgc cggttatgtg gctgtctgtt ttgattacta ctttccttgg gaatgtgtgg      1620
     gttttgaaag aggggggtca tgaggttgtt aattgttctt acctttgggg tttgatattt      1680
     gggagggaca ttgttaggga gagaagggat cgaggggagg aggcggggga tgttgagttg      1740
     actgtttag                                                              1749
//

If you have problems or comments...

PBIL Back to PBIL home page