(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE394

PENCW_10.PE394       Location/Qualifiers
FT   CDS_pept        join(complement(936654..936787),complement(936404..936600),
FT                   complement(936273..936349))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000232011" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978329"
FT                   /orf_name="Pc13g03940"
FT                   /product="Pc13g03940 protein"
FT                   /protein_id="CAP91463.1"
FT                   /db_xref="UniParc:UPI000183084B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H279"
FT                   /transl_table=1
FT                   /translation="MISGIAHINLTIPQDTLEQAEEFYGTTLGLTSAPVPELQKGTILW
FT                   FDIGSSGQQVHITFGATDPQSSRHPCFKLSSREELEEIKANIYNHHLRGGPAAPMAADK
FT                   PGETNSGTQGKEYPTRFFARDFGGNLLEFTM"
     atgatctccg gaattgctca tatcaacctc acaatccctc aggatacatt ggaacaagcc        60
     gaggagttct acggaaccac cctcgggctc acctcagcac cggtaccgga actccagaag       120
     gggacgatct tatggttcga cattggttcc agcggacagc aagtgcatat tactttcggc       180
     gcgactgatc cccaatctag ccggcaccct tgcttcaagc tgtcttcccg tgaggaacta       240
     gaagagatta aagcaaatat ctataaccat catctaaggg gtggccccgc ggctccaatg       300
     gctgctgata agcctggcga gactaactct gggactcaag ggaaagagta tcctactcgg       360
     ttcttcgctc gggattttgg tgggaactta cttgagttca ctatgtaa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page