(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE395

PENCW_10.PE395       Location/Qualifiers
FT   CDS_pept        join(938225..939691,939759..940127)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234886" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672467"
FT                   /orf_name="Pc13g03950"
FT                   /product="Pc13g03950 protein"
FT                   /protein_id="CAP91464.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000183084C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H280"
FT                   /transl_table=1
FT                   /translation="MTAISPMADPLTVLPPEIVLQILHFTPVSALASLTAASKAWHQFI
FT                   DVTHQDAIYTSEAKTAQPIGGSRDFSFLSDTHSYGKVFEGTESWKDLCKRQTLLARNWA
FT                   KPHPVSQESVLQIGNDPVWRFRADFKRRFFVSTSHAGGLNVTDMDTGLLLWQLPSVLDT
FT                   DGDGVRPHAHLEYQDGMAVFDSEGDSLEVWQTDHEGAKRGEFRRIATLNHNCQTRGFQL
FT                   SYWTLCVVSNEGQGFVYDMTQRPPKLTTHLKIEGGGIGHLDQSEDIVIYSMGAKGYFAY
FT                   NKESGAFLGTLKPSPATEKYHVLPPKAASTSTSAALAGAARIGPTPQPLPPGAFRKDCL
FT                   VPIEVAKGPLSPPDDPTHVRHGEDEWGAGMLNGDLFVGFSRAGRVFICSDFRKALRDEA
FT                   SLAANSSVLECESDGSSFDLGGWLSIRNHRIMFEIQDRIYVVALDDNNKVQNVENPARA
FT                   SYSLLTSSAPQLAVPISYMALADDAIMTTYTTLGWRDSNVPGGIPPPQGRELPRVFPTK
FT                   VIRILSLAPNLSTKSSSASGDTDKSSTADNGSLGASGPHLPSADAWRTQAGLLQLLSML
FT                   GEEVESDQSDGEDEWESMNEDDEEEEEEEEEDEEN"
     atgaccgcca tctcaccaat ggcggacccc ctcaccgtct tgcccccaga gattgtcctg        60
     caaatcttgc acttcacccc cgtctccgcc cttgcgtccc tgaccgcggc ctctaaggct       120
     tggcaccaat ttatcgacgt cacccaccaa gacgctattt acacctccga agccaaaacc       180
     gcccagccga ttggaggtag ccgcgatttc tccttcctct ccgataccca cagctatggc       240
     aaagtattcg agggcacaga atcatggaaa gacctgtgca agcgccaaac actgctggct       300
     cgcaattggg ccaagccgca tccagtcagc caggaatcgg tcctacaaat tggcaatgat       360
     ccggtttggc gattccgcgc cgacttcaag cgccgctttt tcgtttccac ttcccatgct       420
     ggcgggttga acgtcactga tatggacacg ggccttttac tttggcaact cccttcggtg       480
     ctggacaccg acggagacgg agttcgccca cacgcacact tggaatatca ggatggaatg       540
     gctgtgtttg atagtgaagg agactcgctc gaggtgtggc agacggacca tgaaggtgca       600
     aagcgtggag agttccggcg catcgctacc ttgaaccata attgccagac gagagggttc       660
     caattgtcct actggactct ctgcgttgtt tctaacgagg gtcaggggtt cgtgtacgat       720
     atgacccagc gacctcctaa gttgacaaca cacctgaaga tcgagggagg tggtattggc       780
     catctggacc aaagtgaaga catcgtgatt tattccatgg gagcaaaggg ctattttgcc       840
     tacaataagg agtctggtgc attcttaggc acgttgaaac cgtcgccggc gacagaaaag       900
     taccacgtcc ttcctcccaa agccgcctct acttctacaa gtgcagcact agcaggcgca       960
     gcgcgaattg gcccaacacc tcaacccctt ccacccgggg ctttccgaaa agattgtttg      1020
     gtacccattg aggtcgccaa aggtccacta tcgccaccag atgacccaac tcatgtccgg      1080
     catggggagg atgaatgggg agcgggaatg ttgaacggcg atcttttcgt gggcttctct      1140
     cgcgctggtc gtgtctttat atgctccgac ttccgcaagg ctctccgcga cgaagctagt      1200
     ctcgcggcga acagctccgt tttggaatgc gaatcagacg ggtcaagctt tgaccttggt      1260
     ggctggttat cgatccgcaa ccaccgtata atgttcgaaa ttcaagatcg gatctatgtt      1320
     gtcgcccttg acgacaacaa caaggttcaa aatgtggaaa accctgcgcg tgcttcgtac      1380
     tcgctgctca ccagctccgc gccccagctt gctgtgccga ttagttacat ggcgttggct      1440
     gatgatgcta ttatgactac ctacactacc ctcggctggc gagactccaa tgttccaggt      1500
     ggtatacctc ccccgcaagg cagagagctt cctcgcgtct ttcctacgaa agtcatccgc      1560
     atcctcagtc tggcccctaa cctgtccacc aaatcttcat ctgcttccgg cgacacggat      1620
     aagtcttcaa cggcggataa cgggagcctt ggtgcttccg gcccacattt gccatctgca      1680
     gacgcctggc gcacacaggc tgggttatta cagcttctta gcatgcttgg cgaagaggtg      1740
     gagtccgacc agagtgatgg tgaagacgaa tgggagagta tgaatgagga tgatgaggaa      1800
     gaagaagaag aagaagaaga ggacgaggag aattag                                1836
//

If you have problems or comments...

PBIL Back to PBIL home page