(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE396

PENCW_10.PE396       Location/Qualifiers
FT   CDS_pept        join(complement(941167..941307),complement(940623..941117),
FT                   complement(940501..940569))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672468"
FT                   /orf_name="Pc13g03960"
FT                   /product="Pc13g03960 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP91465.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000183084D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H252"
FT                   /transl_table=1
FT                   /translation="MASQLPMADLITEVNPEDLIFFQKLQESANSAVFKVAFHGRICVM
FT                   KVYHDRGPSDYDPSDLEVNLFVCESTAYQRMKANGLCEREVVPDFYGTITKIQPSLWPS
FT                   LHMFHGDNLPPNAILIEYIPNLKPISLSNFSKDYLDKFRQVLDDIHQAGVLHGDAKPRN
FT                   MMISQGKQDRVLWIDFDSAQTFPEGSLSQRQERWVQEENELVDYFIVALAQDFKEGRIN
FT                   RTASYYYEYFVE"
     atggcttccc aattaccaat ggctgacttg attactgaag tgaatcctga ggatttgata        60
     tttttccaga agcttcagga gtctgcgaac tccgctgtct tcaaggtagc tttccatgga       120
     cgaatttgtg tgatgaaagt ataccatgat cgagggccgt ctgattacga tccctcggat       180
     cttgaagtga atctcttcgt ctgcgaatcc acagcttatc aacggatgaa agcaaatggc       240
     ttatgtgagc gagaggttgt tcctgatttt tatgggacga ttacgaaaat acaaccatcg       300
     ctctggccga gcctgcacat gtttcatggg gacaacctgc cgccaaacgc cattctcatc       360
     gagtatattc cgaacttgaa gccaataagc ctatccaact tttcaaagga ttatcttgat       420
     aagttccgcc aagttctcga tgacattcac caggctgggg ttctccatgg cgatgccaaa       480
     ccgagaaata tgatgatatc tcaagggaaa caggatagag tactctggat tgattttgat       540
     tctgcacaaa cgttccctga gggctccctt tcacagagac aagaaagatg ggttcaggaa       600
     gaaaatgagt tggtggatta ttttatcgtg gctttagctc aagatttcaa agagggcaga       660
     ataaaccgca cagcctctta ctattatgaa tactttgtgg agtaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page