(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE397

PENCW_10.PE397       Location/Qualifiers
FT   CDS_pept        complement(941511..942842)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950889"
FT                   /orf_name="Pc13g03970"
FT                   /product="Pc13g03970 protein"
FT                   /protein_id="CAP91466.1"
FT                   /db_xref="InterPro:IPR022137"
FT                   /db_xref="UniParc:UPI000183084E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H253"
FT                   /transl_table=1
FT                   /translation="MELDSFSSFPTSTTTTTTAMSSHQREIPEDSVASYDTALSIDACL
FT                   ASATEEMLEVTEDLAKDEDILRQTLSVRSTISTSRSFAERMQRAEFFQNTPLVVIGRGT
FT                   CGTIFEIPGTESAYKKGSDKAALWNDANLTNIACRAVTETKTCLQEIFPNVSIPRVPVV
FT                   TGWISENDLENWWRENLRRFPKDTRKTGYLFQVQRILPLPKPCREALIHLYFPKTMRES
FT                   AHEDPDNKACLVRPYLGQRRGERELSNPALSLQNFPLYLDQIEELELEVEAIQFAEEMA
FT                   IGLATIHWKACLDGMDMEFVLGSAATNGELPTVVENFKTVAPFDIPAGDVERRQVHLWM
FT                   LDFDKAEQLCLKKSWKSCCDKMVTAVTANDPYFPNPAAMGTLEQKLWDTFERAYLLAAS
FT                   DLLLTQKALPKEASKYPALFLKAWKKRATELAEDTEGDFVEFGE"
     atggagctgg atagtttttc ttctttcccg acatcaacaa caacaacaac aacagcgatg        60
     tcctctcatc agcgcgaaat ccccgaagac tctgtagcct cctacgatac tgcactgtcc       120
     atagatgctt gtttggccag tgctactgaa gaaatgctgg aagttacgga ggatctagca       180
     aaagacgaag acatactgcg acagaccctg agcgtgcgct ccactatatc gacctcccga       240
     agcttcgcag agcgtatgca gcgagcagaa ttttttcaga atactccact tgttgtcatc       300
     ggccggggaa catgcggcac gatctttgag attcctggaa cagagtcagc gtacaaaaaa       360
     ggcagcgata aggccgcact gtggaacgac gcgaacctca ccaacattgc ctgccgtgca       420
     gtcacagaga cgaagacttg tcttcaggaa atattcccaa atgtctcaat ccctcgtgtg       480
     cctgtagtga ctggttggat tagtgagaat gacctggaaa actggtggcg agagaacctg       540
     cgacgattcc caaaggatac ccgaaaaact ggatatcttt tccaagtcca gcggatctta       600
     ccgcttccta agccttgccg tgaagctctt atccatctct atttcccgaa gacaatgcgt       660
     gaatcggcac acgaggaccc ggataataag gcatgcctgg tacgaccata ccttggacag       720
     cgaagaggag agagagaatt gtctaatcca gcactcagcc ttcagaactt tcctctttat       780
     ctcgatcaga tagaggaact cgagttagag gtagaggcta tccaatttgc tgaagagatg       840
     gctattgggc tagctaccat ccactggaag gcttgcttgg acggtatgga catggaattc       900
     gtactcggta gtgcggcaac aaatggagaa cttcctaccg tcgtggagaa cttcaagacc       960
     gtggcgccct ttgatatccc tgcgggtgat gtcgaaagac ggcaggtgca tctctggatg      1020
     cttgactttg ataaggctga acagctttgc ctcaagaaga gctggaagtc ttgctgtgat      1080
     aaaatggtca ctgctgtgac agcgaatgat ccctatttcc ccaacccagc ggctatgggg      1140
     acactcgaac aaaagttatg ggatacattt gagcgcgcct atcttcttgc tgcgtctgat      1200
     cttctgctta cgcagaaggc gttgccaaag gaggcaagta aatacccggc tctatttttg      1260
     aaagcatgga agaagagagc tacagaactg gcagaggaca cggagggtga ttttgtggag      1320
     ttcggcgaat ag                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page