(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE398

PENCW_10.PE398       Location/Qualifiers
FT   CDS_pept        join(complement(944080..947413),complement(943392..943879))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950890"
FT                   /orf_name="Pc13g03980"
FT                   /product="Pc13g03980 protein"
FT                   /protein_id="CAP91467.1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000183084F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H254"
FT                   /transl_table=1
FT                   /translation="MSVLRHGGGGGFLQRRLTKLYTDTKTSCESVTTASKALDDPELVA
FT                   LHGSFQKQRDRLLAWGLDWSDASAAQPNDIDESLTAAGFSDVVESVMSSIQELLNDAEQ
FT                   VQHVDAPMLPSKERKVDIPSKDTLASRPVKTQWTEEDITRSNKILNELTGCIDTLYDLS
FT                   RSRRTMASSMSSSRNSARRPRPNLTSPYDSSHGSFSDSKEKVQSPKQMFDTFTYSPTTT
FT                   HRDSPNPFLPLNHLLIDRSALQLYGAAHDNSPPPYEPVAASSNSRAIGRLKSSASHLLA
FT                   STKESHVSVLVEFMPILAESKMDNKSARLEKLQQSLDQLLQNARISHLGLMRFLGYCID
FT                   NSNSRYAFLYQMPVDYFPFLQNPSDLLKELKPKPLVALLPSAEEYRENRVPNLDTRFRL
FT                   AYDLLMSALHLRSQNAIHGNINSSNVIFFPGRSDASDDESGLVPDLRRPYLTSPARFSG
FT                   DGPTPEPLSSAMYRHPEDKRCVEDDGAWAYDLYSLGLILLEIGLWAPVGRLWKMKYDRS
FT                   WFKHRVEDLYVKKLGPKCGGAYLQAVQLCLDAPNFHLSTQPMTDLGLRVPQIYHYPVLD
FT                   LSDPDGTFSFSMNFMYTICKILWSCCRIDIFSAPSAEELDDCLPLALVPTPEPVTIEDK
FT                   VRAYKSSKREMSNYDKKLPTIPADAWSVANEDKLIEKPQKKRTVKRLPHMEIPDEHLQE
FT                   WNFQIMPRVSRLLQKILKESSESCGVNLIMTGESPESAKTTICVTCASVKKVRMALKKH
FT                   FALGRDDWDLIVLRGDIERSKVPRNRRRRPAKARPNVSNDTPFRQRELNPCHQQRPLCG
FT                   ASIGTFQNEEHLPPVSYGGAVIVDGLPYGLTVHHMLEAPSEDEGQDSGPAEFNQDAPSR
FT                   SAGNWPRDTSNIPHPGFRYDYPEDDSSDMNFDFEVSDMEDGDDPSQGLESGYDEFWLSD
FT                   EDSSDDDSIGPDDDDDDTASIGDTAGIEPGEEPRLLVTQPAIDDVHEDFFPSPEDRDDE
FT                   HLASHSLGYVHASSGVRRWTRKGLKHEIDWALIKVDEARMDPRNIILDTTRSSIARPGR
FT                   PIPPQPIFLNQVARMEELGGLQVHCCGRTSGLQTGQISKAMTLVKLQGRHSFSTSFCVN
FT                   GNFGAPGDSGAWVFDRPTGRVCGHVLAWSAKSNTTYISPMEVTFDDIARTLRASVVSLP
FT                   GDPSRSMGYVDPNSPQAAQYRYQAQRLPGDFGRLTFGAGGSPGPPVPPYPHHYPHPQAH
FT                   HPAYGRPPPPPPPPPGSREAHGPVYSGPVPPIPPSLLAGPRNIERQLA"
     atgtcagtcc tccggcatgg aggaggaggc ggcttcctcc agcggcgcct cacgaagcta        60
     tataccgata cgaaaacctc ctgcgagagt gttacgacag cctcaaaggc cctcgatgat       120
     cctgagctcg tcgccctcca cgggagtttc cagaaacaga gggatcgctt gctggcgtgg       180
     ggtcttgatt ggagcgacgc aagcgccgcg cagcccaacg acatcgacga atctttgact       240
     gctgcaggct tcagcgatgt cgtcgagagt gtcatgtcat cgatccaaga actcctcaac       300
     gatgctgagc aagtccagca tgtggatgcg cccatgcttc cttccaagga acggaaagtc       360
     gatataccgt cgaaggacac cctcgctagc agacctgtta aaacgcaatg gacggaggaa       420
     gatataactc gctcgaacaa gattttgaat gaactcactg gctgcattga tactctttat       480
     gatctctcgc gctcccgccg gacaatggct tccagcatgt catccagcag gaacagcgca       540
     cgccgcccac gacctaatct cacctcacct tacgattcat cgcacggttc attctccgat       600
     tccaaggaga aagtacaaag cccaaagcaa atgttcgata cattcaccta ctcgcccacg       660
     accacgcacc gtgactcccc taatcctttc ttgccattaa accatctcct catcgatcgc       720
     tcagctctgc aactatatgg agcggcgcac gataatagcc ctcctccgta tgaacctgtt       780
     gcggcatctt ccaactcgcg tgccattgga cgactgaagt catcggcgtc gcatcttctc       840
     gcctccacaa aagagtccca tgtctccgtg cttgtcgagt ttatgcctat attggcggag       900
     tcaaaaatgg ataacaagag tgctcgactg gaaaagctcc aacagtctct tgatcagttg       960
     ctacagaacg ccagaatctc acacttgggg ttaatgcgat ttttgggcta ctgcattgat      1020
     aactcgaatt ctcgctatgc attcctttat cagatgccgg tcgactactt cccgttccta      1080
     caaaatccga gtgacttgtt gaaggagtta aagcctaagc cattggtcgc tcttcttcct      1140
     tcagcagagg agtaccggga gaatcgagtt ccgaacctcg acactcgctt tcgattggct      1200
     tacgatctct taatgtccgc tctacacctg agaagtcaaa atgccattca tggaaatatc      1260
     aacagcagca acgtcatctt cttcccgggc cgaagtgatg cgagcgatga tgaaagtggt      1320
     cttgtacctg atcttcgccg tccttatctc acctctccgg cacggttctc tggggatgga      1380
     ccaacccctg agccgttgtc ttcggcaatg tatcgtcacc cagaggacaa gagatgtgtt      1440
     gaggatgatg gcgcgtgggc ctatgacctt tactcgctag gcctcattct attagagata      1500
     ggtctgtggg caccagttgg gcggctttgg aagatgaagt acgaccgctc gtggttcaag      1560
     catcgagtgg aagatcttta tgttaagaag ctcggcccta agtgcggtgg tgcctatctt      1620
     caagctgttc agttgtgcct tgatgccccc aacttccatt tatcgacaca gccgatgaca      1680
     gaccttggtc tccgtgtccc acaaatttac cactacccgg tactagactt gtcggaccct      1740
     gatggcactt tctctttttc gatgaacttc atgtatacaa tctgcaagat actgtggtca      1800
     tgttgccgga ttgatatctt ctcggcaccc tcggcagaag aattggatga ctgccttcca      1860
     ctcgcccttg tccccacccc cgagccggtc accatcgagg ataaagtcag ggcatacaag      1920
     tcatcgaagc gcgagatgtc taattatgac aagaagcttc ccacgattcc agccgatgca      1980
     tggagtgtcg cgaatgaaga caaactcatt gaaaagccgc aaaagaaacg gaccgtcaag      2040
     aggcttccgc acatggaaat accggacgag cacctacaag agtggaattt ccaaataatg      2100
     cctcgagtga gtcgccttct tcagaagatc ttaaaggagt cctccgagtc atgtggagta      2160
     aacctcatca tgactggcga atcgcctgaa agtgccaaaa cgacgatttg tgttacttgc      2220
     gccagtgtga agaaagttcg aatggccctc aagaagcatt ttgctctagg tcgggatgac      2280
     tgggatttga ttgtcctccg tggcgatatc gaacgctcca aggttcctcg caaccggcgc      2340
     cggagaccgg ccaaagcccg cccgaatgta tccaatgata cacccttccg tcagcgagag      2400
     ctcaatccat gtcaccagca gcgacctcta tgcggagcat ccatcggtac ttttcagaac      2460
     gaagagcacc taccccctgt ctcatatggt ggtgccgtca tcgtcgatgg cttaccgtat      2520
     ggcttaacgg tacatcatat gttggaagct cctagtgaag atgagggcca agacagtggc      2580
     cccgcagagt tcaaccaaga cgccccttcc aggtcggcgg ggaattggcc ccgtgataca      2640
     tcaaatatcc cacatcctgg attcaggtat gactatccag aggatgactc gtctgacatg      2700
     aacttcgatt tcgaagtttc cgatatggag gacggagacg atccgtcaca aggccttgag      2760
     tctgggtatg atgaattctg gctttcagat gaagattcat cagatgatga ctccattggc      2820
     cccgatgacg atgatgatga caccgcgtct atcggcgata ctgcgggcat tgaacccggc      2880
     gaagaacctc ggctgcttgt cacccaacca gctattgacg atgtacatga agactttttt      2940
     ccatctccag aagatcgcga tgacgagcat ctagcctcgc actccctagg ttatgtccac      3000
     gcatcatctg gagtacggcg ctggactcgg aaaggtctga aacatgagat tgactgggca      3060
     ctcatcaaag tcgatgaagc ccgcatggac cctcgcaaca ttattctgga tactaccaga      3120
     tccagtatcg ctcgtccggg tcgccctatc ccgccacaac ctatatttct gaaccaggtg      3180
     gcccggatgg aggagctagg tggcttgcaa gttcattgct gtggtcgcac aagtggactt      3240
     caaacagggc agatatccaa agctatgaca ttggtcaaac tccagggaag gcattcattc      3300
     tcaaccagct tttgcgtcaa cgggaacttc ggagcccctg gcgactccgg cgcatgggtc      3360
     tttgaccgtc ccacgggccg tgtctgcggc catgttctcg cctggtccgc aaaaagcaat      3420
     accacctaca tttcccctat ggaagtcacc ttcgatgaca tcgcacgcac gctccgcgcc      3480
     tctgtcgtct ccctccctgg cgacccgagc cgatctatgg gttacgtcga ccctaactcc      3540
     ccgcaggccg ctcaataccg ctatcaggca cagcggctgc caggggactt tggtcgtttg      3600
     acttttggag ctggaggttc ccccggtccg cctgtaccac catatcccca ccattatcct      3660
     caccctcaag cccaccatcc ggcttacgga cgtcctccac ctccgcctcc accccctccc      3720
     ggctcccgag aagcccatgg gcccgtgtac agtggccccg tccctccgat tcctccgtcc      3780
     cttctggctg ggccccgcaa tatcgagcga caacttgctt ga                         3822
//

If you have problems or comments...

PBIL Back to PBIL home page